Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human OTX2 protein

This Human OTX2 protein spans the amino acid sequence from region 1-297aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

OTX2

UniProt

P32243

Expression Region

1-297aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Stem Cell & Developmental Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

48.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Isoform2 of His-SUMO-tag and expression region is 1-297aa

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MMSYLKQPPYAVNGLSLTTSGMDLLHPSVGYPGPWASCPAATPRKQRRERTTFTRAQLDVLEALFAKTRYPDIFMREEVALKINLPESRVQVWFKNRRAKCRQQQQQQQNGGQNKVRPAKKKTSPAREVSSESGTSGQFTPPSSTSVPTIASSSAPVSIWSPASISPLSDPLSTSSSCMQRSYPMTYTQASGYSQGYAGSTSYFGGMDCGSYLTPMHHQLPGPGATLSPMGTNAVTSHLNQSPASLSTQGYGASSLGFNSTTDCLDYKDQTASWKLNFNADCLDYKDQTSSWKFQVL

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

TRP2 Rabbit Polyclonal Antibody
orb382702-01 30 µL

TRP2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
TRP2 Rabbit Polyclonal Antibody
orb382702-02 50 μL

TRP2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
TRP2 Rabbit Polyclonal Antibody
orb382702-03 100 µL

TRP2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
TRP2 Rabbit Polyclonal Antibody
orb382702-04 200 µL

TRP2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Standard slide box for 12 microscope slides. Strong storage cases of best quality coated with leatherette paper and furnished with numbered serrated retainer strips.
K12 11 x 7 x 4 cm

Standard slide box for 12 microscope slides. Strong storage cases of best quality coated with leatherette paper and furnished with numbered serrated retainer strips.

Sign In for Pricing
View Details
Recombinant Brucella abortus Type IV secretion system protein virB3 (virB3), partial
MBS7076992 Inquire

Recombinant Brucella abortus Type IV secretion system protein virB3 (virB3), partial

Sign In for Pricing
View Details