Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

E.coli N14#1 protein

This E.coli N14#1 protein spans the amino acid sequence from region 24-131aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

N14#1

UniProt

Q9TVT2

Expression Region

24-131aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Pinctada fucata (Akoya pearl oyster) (Pinctada imbricata fucata)

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

28.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-SUMO-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

AYHKKCGRYSYCWIPYDIERDRRDNGGKKYCFCRYAWSPWQCNEEERYEWLRCGMRFYSLCCYTDDDNGNGNGNGNGNGLNYLKSLYGGYGNGNGEFREEYIDERYDN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cleaved PARP1 Mouse Monoclonal Antibody (Cy5.5)
orb1081836 100 µL

Cleaved PARP1 Mouse Monoclonal Antibody (Cy5.5)

Sign In for Pricing
View Details
Lentiviral human TMSB15B shRNA (UAS) - Lentiviral human TMSB15B shRNA (UAS) plasmid
GTR15283543 1 Vial

Lentiviral human TMSB15B shRNA (UAS) - Lentiviral human TMSB15B shRNA (UAS) plasmid

Sign In for Pricing
View Details
PCDHB14, NT (PCDHB14, Protocadherin beta-14) (AP)
MBS6331605-01 0.2 mL

PCDHB14, NT (PCDHB14, Protocadherin beta-14) (AP)

Sign In for Pricing
View Details
PCDHB14, NT (PCDHB14, Protocadherin beta-14) (AP)
MBS6331605-02 5x 0.2 mL

PCDHB14, NT (PCDHB14, Protocadherin beta-14) (AP)

Sign In for Pricing
View Details
Anti-TLS/FUS Antibody Picoband® (Carrier-free Conjugate)
A00771-1-carrier-free 100 µg/Vial

Anti-TLS/FUS Antibody Picoband® (Carrier-free Conjugate)

Sign In for Pricing
View Details
PER3 Rabbit Polyclonal Antibody (HRP)
orb2613274 100 µg

PER3 Rabbit Polyclonal Antibody (HRP)

Sign In for Pricing
View Details