Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rat Mmp2 protein

This Rat Mmp2 protein spans the amino acid sequence from region 110-662aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Mmp2

UniProt

P33436

Expression Region

110-662aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Rattus norvegicus (Rat)

Field of Research

Cardiovascular Research

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

78.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full length of 72 kDa type IV collagenase chain of His-SUMO-tag and expression region is 110-662aa

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

YNFFPRKPKWDKNQITYRIIGYTPDLDPETVDDAFARALKVWSDVTPLRFSRIHDGEADIMINFGRWEHGDGYPFDGKDGLLAHAFAPGTGVGGDSHFDDDELWTLGEGQVVRVKYGNADGEYCKFPFLFNGREYSSCTDTGRSDGFLWCSTTYNFEKDGKYGFCPHEALFTMGGNGDGQPCKFPFRFQGTSYNSCTTEGRTDGYRWCGTTEDYDRDKKYGFCPETAMSTVGGNSEGAPCVFPFTFLGNKYESCTSAGRSDGKVWCATTTNYDDDRKWGFCPDQGYSLFLVAAHEFGHAMGLEHSQDPGALMAPIYTYTKNFRLSNDDIKGIQELYGPSPDADTDTGTGPTPTLGPVTPEICKQDIVFDGIAQIRGEIFFFKDRFIWRTVTPRDKPTGPLLVATFWPELPEKIDAVYEAPQEEKAVFFAGNEYWVYSASTLERGYPKPLTSLGLPPDVQQVDAAFNWSKNKKTYIFSGDKFWRYNEVKKKMDPGFPKLIADSWNAIPDNLDAVVDLQGGGHSYFFKGAYYLKLENQSLKSVKFGSIKSDWLGC

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RCC2 Polyclonal Antibody, HRP Conjugated
bs-7768R-HRP 100 µL

RCC2 Polyclonal Antibody, HRP Conjugated

Sign In for Pricing
View Details
OLR1 (Oxidized Low Density Lipoprotein Receptor 1, LOX1, LOXIN, SLOX1, CLEC8A, SCARE1) (AP)
MBS6430148-01 0.1 mL

OLR1 (Oxidized Low Density Lipoprotein Receptor 1, LOX1, LOXIN, SLOX1, CLEC8A, SCARE1) (AP)

Sign In for Pricing
View Details
OLR1 (Oxidized Low Density Lipoprotein Receptor 1, LOX1, LOXIN, SLOX1, CLEC8A, SCARE1) (AP)
MBS6430148-02 5x 0.1 mL

OLR1 (Oxidized Low Density Lipoprotein Receptor 1, LOX1, LOXIN, SLOX1, CLEC8A, SCARE1) (AP)

Sign In for Pricing
View Details
SEC61G2 Antibody
orb796070 2 mg

SEC61G2 Antibody

Sign In for Pricing
View Details
Rat TATA Box Binding Protein Associated Factor 1 ELISA Kit
MBS720874-01 48 Well

Rat TATA Box Binding Protein Associated Factor 1 ELISA Kit

Sign In for Pricing
View Details
Rat TATA Box Binding Protein Associated Factor 1 ELISA Kit
MBS720874-02 96 Well

Rat TATA Box Binding Protein Associated Factor 1 ELISA Kit

Sign In for Pricing
View Details