Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human IL1F10 protein

This Human IL1F10 protein spans the amino acid sequence from region 1-152aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

IL1F10

UniProt

Q8WWZ1

Expression Region

1-152aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

32.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-SUMO-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MCSLPMARYYIIKYADQKALYTRDGQLLVGDPVADNCCAEKICILPNRGLARTKVPIFLGIQGGSRCLACVETEEGPSLQLEDVNIEELYKGGEEATRFTFFQSSSGSAFRLEAAAWPGWFLCGPAEPQQPVQLTKESEPSARTKFYFEQSW

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Bovine IBP2 ELISA Kit
E103405 1 Each

Bovine IBP2 ELISA Kit

Sign In for Pricing
View Details
ZIK1 ORF Vector (Human) (pORF)
51251011 1.0 µg DNA

ZIK1 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
Rat Cenpw Pre-designed siRNA Set B
SI202530B 1 Each

Rat Cenpw Pre-designed siRNA Set B

Sign In for Pricing
View Details
Phospho-VANGL2-S79/S82/S84 Rabbit mAb
E45R11772N-50 50 µL

Phospho-VANGL2-S79/S82/S84 Rabbit mAb

Sign In for Pricing
View Details
5'-AMP-Activated Protein Kinase Catalytic Subunit Alpha-2 (PRKAA2) Antibody
abx114809 100 µL

5'-AMP-Activated Protein Kinase Catalytic Subunit Alpha-2 (PRKAA2) Antibody

Sign In for Pricing
View Details
7ACC2 5mg
A15785-5 5 mg

7ACC2 5mg

Sign In for Pricing
View Details