Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human IL1F10 protein

This Human IL1F10 protein spans the amino acid sequence from region 1-152aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

IL1F10

UniProt

Q8WWZ1

Expression Region

1-152aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

32.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-SUMO-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MCSLPMARYYIIKYADQKALYTRDGQLLVGDPVADNCCAEKICILPNRGLARTKVPIFLGIQGGSRCLACVETEEGPSLQLEDVNIEELYKGGEEATRFTFFQSSSGSAFRLEAAAWPGWFLCGPAEPQQPVQLTKESEPSARTKFYFEQSW

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

ACTN1 (Alpha-actinin-1, Alpha-actinin Cytoskeletal Isoform, Non-muscle alpha-actinin-1, F-actin Cross-linking Protein) (FITC)
122929-FITC 100 µL

ACTN1 (Alpha-actinin-1, Alpha-actinin Cytoskeletal Isoform, Non-muscle alpha-actinin-1, F-actin Cross-linking Protein) (FITC)

Sign In for Pricing
View Details
Beta-Amyloid (1-42) Monoclonal Antibody, Cy3 Conjugated
bsm-41490M-Cy3 100 µL

Beta-Amyloid (1-42) Monoclonal Antibody, Cy3 Conjugated

Sign In for Pricing
View Details
Human TYR (Tyrosinase) ELISA Kit
EH25501 96 Tests

Human TYR (Tyrosinase) ELISA Kit

Sign In for Pricing
View Details
Sulfometuron methyl
466634-01 100 mg

Sulfometuron methyl

Sign In for Pricing
View Details
Sulfometuron methyl
466634-02 250 mg

Sulfometuron methyl

Sign In for Pricing
View Details
IER2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)
K1015807 1.0 µg DNA

IER2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)

Sign In for Pricing
View Details