Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Sheep IL8 protein

This Sheep IL8 protein spans the amino acid sequence from region 23-101aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

310C protein, 9E3 protein, AMCF1 protein, CEF-4 protein, chemokine, CXC motif, ligand 8 protein, CXC chemokine ligand 8 protein, CXC chemokine ligand 8 protein, CXCL 8 protein, Emoctakin protein, GCP 1 protein, GCP-1 protein, GCP1 protein, Granulocyte chemotactic protein 1 protein, IL 8 protein, IL8/NAP1 form I protein, Inteleukin 8 protein, Interleukin8 protein, K60 protein, LECT protein, LECT protein, LYNAP protein, MDNCF protein, Monocyte derived neutrophil activating peptide protein, NAF protein, NAP 1 protein, Neutrophil activating factor protein, Neutrophil activating factor protein, Neutrophil activating peptide 1 protein, SCYB8 protein, T-cell chemotactic factor protein, TSG1 protein

UniProt

P36925

Expression Region

23-101aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Ovis aries (Sheep)

Field of Research

Epigenetics, Immunology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

13.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full length of His-tag and expression region is 23-101aa

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

AVLSRMSTELRCQCIKTHSTPFHPKFIKELRVIESGPHCENSEIIVKLTNGKEVCLDPKEKWVQKVVQAFLKRAEKQDP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human CASP8 shRNA (UAS) - Lentiviral human CASP8 shRNA (UAS, GFP) plasmid
GTR15312469 1 Vial

Lentiviral human CASP8 shRNA (UAS) - Lentiviral human CASP8 shRNA (UAS, GFP) plasmid

Sign In for Pricing
View Details
Human E3 ubiquitin-protein ligase LNX, LNX1 ELISA Kit
MBS9341194-01 48 Well

Human E3 ubiquitin-protein ligase LNX, LNX1 ELISA Kit

Sign In for Pricing
View Details
Human E3 ubiquitin-protein ligase LNX, LNX1 ELISA Kit
MBS9341194-02 96 Well

Human E3 ubiquitin-protein ligase LNX, LNX1 ELISA Kit

Sign In for Pricing
View Details
Human E3 ubiquitin-protein ligase LNX, LNX1 ELISA Kit
MBS9341194-03 5x 96 Well

Human E3 ubiquitin-protein ligase LNX, LNX1 ELISA Kit

Sign In for Pricing
View Details
Human E3 ubiquitin-protein ligase LNX, LNX1 ELISA Kit
MBS9341194-04 10x 96 Well

Human E3 ubiquitin-protein ligase LNX, LNX1 ELISA Kit

Sign In for Pricing
View Details
DMT-2'-O-TBS-rA (Bz) -3'- (L) -PSM-Phosphoramidite
PA148-1 1 g

DMT-2'-O-TBS-rA (Bz) -3'- (L) -PSM-Phosphoramidite

Sign In for Pricing
View Details