Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Sheep IL1B protein

This Sheep IL1B protein spans the amino acid sequence from region 114-266aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

IL1B

UniProt

P21621

Expression Region

114-266aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Ovis aries (Sheep)

Field of Research

Immunology & Inflammation

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

21.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full length of His-tag and expression region is 114-266aa

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

AAVQSVKCKLQDREQKSLVLDSPCVLKALHLPSQEMSREVVFCMSFVQGEERDNKIPVALGIRDKNLYLSCVKKGDTPTLQLEEVDPKVYPKRNMEKRFVFYKTEIKNTVEFESVLYPNWYISTSQIEEKPVFLGRFRGGQDITDFRMETLSP

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Cysteine and histidine rich domain containing protein 1 (CHORDC1) ELISA kit
GTR10405503 96 Well

Rat Cysteine and histidine rich domain containing protein 1 (CHORDC1) ELISA kit

Sign In for Pricing
View Details
Anti-GDF6 Rabbit pAb
GB111654-50 50 μL

Anti-GDF6 Rabbit pAb

Sign In for Pricing
View Details
Lacto-N-fucopentaose III-APD-HSA
OL06041 0.5 mg

Lacto-N-fucopentaose III-APD-HSA

Sign In for Pricing
View Details
Htr6 (NM_024365) Rat Tagged ORF Clone Lentiviral Particle
RR211220L4V 200 µL

Htr6 (NM_024365) Rat Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
FBLN1 (fibulin 1, FBLN) (HRP)
246000-HRP 100 µL

FBLN1 (fibulin 1, FBLN) (HRP)

Sign In for Pricing
View Details
Mouse Wfs1 Pre-designed siRNA Set B
SI116066B 1 Each

Mouse Wfs1 Pre-designed siRNA Set B

Sign In for Pricing
View Details