Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human ID1 protein

This Human ID1 protein spans the amino acid sequence from region 1-155aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

ID1

UniProt

P41134

Expression Region

1-155aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Stem Cell & Developmental Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

32.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full length of His-SUMO-tag and expression region is 1-155aa

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MKVASGSTATAAAGPSCALKAGKTASGAGEVVRCLSEQSVAISRCAGGAGARLPALLDEQQVNVLLYDMNGCYSRLKELVPTLPQNRKVSKVEILQHVIDYIRDLQLELNSESEVGTPGGRGLPVRAPLSTLNGEISALTAEAACVPADDRILCR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ABCA2 Antibody
A11503-100UL 100 µL

ABCA2 Antibody

Sign In for Pricing
View Details
Rabbit Cone-rod homeobox protein (CRX) ELISA Kit
MBS7243642-01 48 Well

Rabbit Cone-rod homeobox protein (CRX) ELISA Kit

Sign In for Pricing
View Details
Rabbit Cone-rod homeobox protein (CRX) ELISA Kit
MBS7243642-02 96 Well

Rabbit Cone-rod homeobox protein (CRX) ELISA Kit

Sign In for Pricing
View Details
Rabbit Cone-rod homeobox protein (CRX) ELISA Kit
MBS7243642-03 5x 96 Well

Rabbit Cone-rod homeobox protein (CRX) ELISA Kit

Sign In for Pricing
View Details
Rabbit Cone-rod homeobox protein (CRX) ELISA Kit
MBS7243642-04 10x 96 Well

Rabbit Cone-rod homeobox protein (CRX) ELISA Kit

Sign In for Pricing
View Details
Os01g0618500 Antibody
orb841890 2 mg

Os01g0618500 Antibody

Sign In for Pricing
View Details