Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human ID1 protein

This Human ID1 protein spans the amino acid sequence from region 1-155aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

ID1

UniProt

P41134

Expression Region

1-155aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Stem Cell & Developmental Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

32.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full length of His-SUMO-tag and expression region is 1-155aa

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MKVASGSTATAAAGPSCALKAGKTASGAGEVVRCLSEQSVAISRCAGGAGARLPALLDEQQVNVLLYDMNGCYSRLKELVPTLPQNRKVSKVEILQHVIDYIRDLQLELNSESEVGTPGGRGLPVRAPLSTLNGEISALTAEAACVPADDRILCR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

4-Hydroxybiphenyl-d9 (rings-d9)
TRC-P336136-25MG 25 mg

4-Hydroxybiphenyl-d9 (rings-d9)

Sign In for Pricing
View Details
Lentiviral mouse Amot shRNA (UAS) - Lentiviral mouse Amot shRNA (UAS) plasmid
GTR15209599 1 Vial

Lentiviral mouse Amot shRNA (UAS) - Lentiviral mouse Amot shRNA (UAS) plasmid

Sign In for Pricing
View Details
Apoptosis (Mouse) BioAssayTM Sample Kit discontinued
A1059-89A 8x20ul

Apoptosis (Mouse) BioAssayTM Sample Kit discontinued

Sign In for Pricing
View Details
Citrate synthetase Rabbit mAb (AMR11536N)
AMR11536N-01 50 µL

Citrate synthetase Rabbit mAb (AMR11536N)

Sign In for Pricing
View Details
Citrate synthetase Rabbit mAb (AMR11536N)
AMR11536N-02 100 µL

Citrate synthetase Rabbit mAb (AMR11536N)

Sign In for Pricing
View Details
Citrate synthetase Rabbit mAb (AMR11536N)
AMR11536N-03 200 µL

Citrate synthetase Rabbit mAb (AMR11536N)

Sign In for Pricing
View Details