Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rat Hpx protein

This Rat Hpx protein spans the amino acid sequence from region 24-460aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Hpx

UniProt

P20059

Expression Region

24-460aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Rattus norvegicus (Rat)

Field of Research

Epigenetics

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

52.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full length of His-tag and expression region is 24-460aa

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

NPLPAAHETVAKGENGTKPDSDVIEHCSDAWSFDATTMDHNGTMLFFKGEFVWRGHSGIRELISERWKNPVTSVDAAFRGPDSVFLIKEDKVWVYPPEKKENGYPKLFQEEFPGIPYPPDAAVECHRGECQSEGVLFFQGNRKWFWDFATRTQKERSWPAVGNCTAALRWLERYYCFQGNKFLRFNPVTGEVPPRYPLDARDYFISCPGRGHGKLRNGTAHGNSTHPMHSRCNADPGLSALLSDHRGATYAFSGSHYWRLDSSRDGWHSWPIAHHWPQGPSAVDAAFSWDEKVYLIQGTQVYVFLTKGGNNLVSGYPKRLEKELGSPPGISLDTIDAAFSCPGSSKLYVTSGRRLWWLDLKSGAQATWAELSWPHEKVDGALCLEKSLGPYSCSSNGPNLFFIHGPNLYCYSSIDKLNAAKSLPQPQKVNSILGCSQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ReadiLink™ Rapid iFluor® 633 Antibody Labeling Kit *Microscale Optimized for Labeling 50 μg Antibody Per Reaction*
1260-AAT 2 Labelings

ReadiLink™ Rapid iFluor® 633 Antibody Labeling Kit *Microscale Optimized for Labeling 50 μg Antibody Per Reaction*

Sign In for Pricing
View Details
Cyclin D1 (DCS-6), CF405S conjugate, 0.1mg/mL
BNC040007-500 1x 500 µL

Cyclin D1 (DCS-6), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Mif4gd (BC019515) Mouse Tagged ORF Clone
MG201336 10 µg

Mif4gd (BC019515) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
CDY2B (NM_001001722) Human Over-expression Lysate
LY424221 100 µg

CDY2B (NM_001001722) Human Over-expression Lysate

Sign In for Pricing
View Details
IL-4 / Interleukin 4 (IL4/1597), CF405S conjugate, 0.1mg/mL
BNC041597-100 1x 100 µL

IL-4 / Interleukin 4 (IL4/1597), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
PDGFA Polyclonal Antibody
E-AB-12839-01 20 µL

PDGFA Polyclonal Antibody

Sign In for Pricing
View Details