Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rat Hpx protein

This Rat Hpx protein spans the amino acid sequence from region 24-460aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Hpx

UniProt

P20059

Expression Region

24-460aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Rattus norvegicus (Rat)

Field of Research

Epigenetics

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

52.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full length of His-tag and expression region is 24-460aa

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

NPLPAAHETVAKGENGTKPDSDVIEHCSDAWSFDATTMDHNGTMLFFKGEFVWRGHSGIRELISERWKNPVTSVDAAFRGPDSVFLIKEDKVWVYPPEKKENGYPKLFQEEFPGIPYPPDAAVECHRGECQSEGVLFFQGNRKWFWDFATRTQKERSWPAVGNCTAALRWLERYYCFQGNKFLRFNPVTGEVPPRYPLDARDYFISCPGRGHGKLRNGTAHGNSTHPMHSRCNADPGLSALLSDHRGATYAFSGSHYWRLDSSRDGWHSWPIAHHWPQGPSAVDAAFSWDEKVYLIQGTQVYVFLTKGGNNLVSGYPKRLEKELGSPPGISLDTIDAAFSCPGSSKLYVTSGRRLWWLDLKSGAQATWAELSWPHEKVDGALCLEKSLGPYSCSSNGPNLFFIHGPNLYCYSSIDKLNAAKSLPQPQKVNSILGCSQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SYNPO2L Antibody
MBS9408531-01 0.1 mL

SYNPO2L Antibody

Sign In for Pricing
View Details
SYNPO2L Antibody
MBS9408531-02 5x 0.1 mL

SYNPO2L Antibody

Sign In for Pricing
View Details
Anti-Mesothelin/Msln Antibody Picoband® Fluoro488 Conjugated
A03266-1-Fluoro488 100 µg/Vial

Anti-Mesothelin/Msln Antibody Picoband® Fluoro488 Conjugated

Sign In for Pricing
View Details
N-Nitroso Lurbinectedin Impurity 2
CS-O-62365 1 Each

N-Nitroso Lurbinectedin Impurity 2

Sign In for Pricing
View Details
NDUFS1 Protein Vector (Rat) (pPB-N-His)
PV284767 500 ng

NDUFS1 Protein Vector (Rat) (pPB-N-His)

Sign In for Pricing
View Details
HER3 Antibody
F50603-0.4ML 0.4 mL

HER3 Antibody

Sign In for Pricing
View Details