Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Hist1h2bm protein

This Mouse Hist1h2bm protein spans the amino acid sequence from region 2-126aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Hist1h2bm

UniProt

P10854

Expression Region

2-126aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Epigenetics

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

17.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full length of His-tag and expression region is 2-126aa

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

PEPTKSAPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSVYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSSK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Vanin 1 (VNN1) ELISA Kit-Sandwich
EK6F604-01 48 Test

Mouse Vanin 1 (VNN1) ELISA Kit-Sandwich

Sign In for Pricing
View Details
Mouse Vanin 1 (VNN1) ELISA Kit-Sandwich
EK6F604-02 96 Tests

Mouse Vanin 1 (VNN1) ELISA Kit-Sandwich

Sign In for Pricing
View Details
Adipic acid
GK2348-1kg 1 Kg

Adipic acid

Sign In for Pricing
View Details
HCN3 Protein Vector (Human) (pPB-C-His)
PV019313 500 ng

HCN3 Protein Vector (Human) (pPB-C-His)

Sign In for Pricing
View Details
GIMAP7 Human qPCR Template Standard (NM_153236)
HK203345 1 Kit

GIMAP7 Human qPCR Template Standard (NM_153236)

Sign In for Pricing
View Details
C13orf44 (SMIM2) Human shRNA Plasmid Kit (Locus ID 79024)
TR317451 1 Kit

C13orf44 (SMIM2) Human shRNA Plasmid Kit (Locus ID 79024)

Sign In for Pricing
View Details