Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Hist1h2bm protein

This Mouse Hist1h2bm protein spans the amino acid sequence from region 2-126aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Hist1h2bm

UniProt

P10854

Expression Region

2-126aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Epigenetics

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

17.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full length of His-tag and expression region is 2-126aa

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

PEPTKSAPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSVYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSSK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PIK3R2 Recombinant Protein (Rat)
RP220556 100 µg

PIK3R2 Recombinant Protein (Rat)

Sign In for Pricing
View Details
CD137L Antibody / 4-1BBL / TNFSF9
V8184BTN 500 µL

CD137L Antibody / 4-1BBL / TNFSF9

Sign In for Pricing
View Details
OSGIN2 Rabbit Polyclonal Antibody (Cy5.5)
orb2444824 100 µL

OSGIN2 Rabbit Polyclonal Antibody (Cy5.5)

Sign In for Pricing
View Details
Vmn2r114 ORF Vector (Mouse) (pORF)
ORF061510 1.0 µg DNA

Vmn2r114 ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details
Goat Dermatan-Sulfate Epimerase-Like Protein (DSEL) ELISA Kit
MBS9921062 Inquire

Goat Dermatan-Sulfate Epimerase-Like Protein (DSEL) ELISA Kit

Sign In for Pricing
View Details
Avian Super Oxidase Dimutase (SOD) ELISA Kit
SL0092BI-01 48 Tests

Avian Super Oxidase Dimutase (SOD) ELISA Kit

Sign In for Pricing
View Details