Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human COTL1 protein

This Human COTL1 protein spans the amino acid sequence from region 2-142aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

COTL1

UniProt

Q14019

Expression Region

2-142aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Musculoskeletal & Connective Tissue Research

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

31.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-SUMO-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

ATKIDKEACRAAYNLVRDDGSAVIWVTFKYDGSTIVPGEQGAEYQHFIQQCTDDVRLFAFVRFTTGDAMSKRSKFALITWIGENVSGLQRAKTGTDKTLVKEVVQNFAKEFVISDRKELEEDFIKSELKKAGGANYDAQTE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FARP2 Antibody, Biotin conjugated
MBS1496900-01 0.05 mg

FARP2 Antibody, Biotin conjugated

Sign In for Pricing
View Details
FARP2 Antibody, Biotin conjugated
MBS1496900-02 0.1 mg

FARP2 Antibody, Biotin conjugated

Sign In for Pricing
View Details
FARP2 Antibody, Biotin conjugated
MBS1496900-03 5x 0.1 mg

FARP2 Antibody, Biotin conjugated

Sign In for Pricing
View Details
RBMS3 (Biotin)
574445-01 50 µg

RBMS3 (Biotin)

Sign In for Pricing
View Details
RBMS3 (Biotin)
574445-02 100 µg

RBMS3 (Biotin)

Sign In for Pricing
View Details
Cysteinyl leukotriene Receptor 1 (CYSLTR1) Porcine ELISA Kit
C7358 96 Tests

Cysteinyl leukotriene Receptor 1 (CYSLTR1) Porcine ELISA Kit

Sign In for Pricing
View Details