Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human GUCA2B protein

This Human GUCA2B protein spans the amino acid sequence from region 27-112aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

GUCA2B

UniProt

Q16661

Expression Region

27-112aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

25.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-SUMO-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

VYIQYQGFRVQLESMKKLSDLEAQWAPSPRLQAQSLLPAVCHHPALPQDLQPVCASQEASSIFKTLRTIANDDCELCVNVACTGCL

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Phospho-BRCA1 antibody
70R-11991 100 ug

Phospho-BRCA1 antibody

Sign In for Pricing
View Details
Lentiviral human SERPINI1 sgRNA gene knockout kit - Lentiviral human SERPINI1 sgRNA gene knockout kit (plasmid)
GTR15382487 1 Vial

Lentiviral human SERPINI1 sgRNA gene knockout kit - Lentiviral human SERPINI1 sgRNA gene knockout kit (plasmid)

Sign In for Pricing
View Details
Tumor rejection antigen P815A
orb1645495-01 50 µg

Tumor rejection antigen P815A

Sign In for Pricing
View Details
Tumor rejection antigen P815A
orb1645495-02 100 µg

Tumor rejection antigen P815A

Sign In for Pricing
View Details
Tumor rejection antigen P815A
orb1645495-03 1 mg

Tumor rejection antigen P815A

Sign In for Pricing
View Details
5Z,8Z,11Z,14Z-Eicosatetraenoic acid, 3-thienylmethyl ester
HY-121830 1 Each

5Z,8Z,11Z,14Z-Eicosatetraenoic acid, 3-thienylmethyl ester

Sign In for Pricing
View Details