Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human LUC7L3 protein

This Human LUC7L3 protein spans the amino acid sequence from region 1-79aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

LUC7L3

UniProt

O95232

Expression Region

1-79aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Epigenetics & Chromatin

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

13.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MISAAQLLDELMGRDRNLAPDEKRSNVRWDHESVCKYYLCGFCPAELFTNTRSDLGPCEKIHDENLRKQYEKSSRFMKV

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

ATP5A1P9 Protein Vector (Human) (pPB-His-GST)
PV325099 500 ng

ATP5A1P9 Protein Vector (Human) (pPB-His-GST)

Sign In for Pricing
View Details
Cytochrome P450 3A4 (CYP3A4) Rabbit Polyclonal Antibody
TA324141 100 µL

Cytochrome P450 3A4 (CYP3A4) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
TER-119 / Erythroid Cell Antibody
abx200929-01 100 µg

TER-119 / Erythroid Cell Antibody

Sign In for Pricing
View Details
TER-119 / Erythroid Cell Antibody
abx200929-02 500 µg

TER-119 / Erythroid Cell Antibody

Sign In for Pricing
View Details
NAT-5 Lentiviral Activation Particles (h2)
sc-404689-LAC-2 200 µL

NAT-5 Lentiviral Activation Particles (h2)

Sign In for Pricing
View Details
SPATA31A5 Human shRNA Plasmid Kit (Locus ID 727905)
TR321168 1 Kit

SPATA31A5 Human shRNA Plasmid Kit (Locus ID 727905)

Sign In for Pricing
View Details