Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human LUC7L3 protein

This Human LUC7L3 protein spans the amino acid sequence from region 1-79aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

LUC7L3

UniProt

O95232

Expression Region

1-79aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Epigenetics & Chromatin

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

13.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MISAAQLLDELMGRDRNLAPDEKRSNVRWDHESVCKYYLCGFCPAELFTNTRSDLGPCEKIHDENLRKQYEKSSRFMKV

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Multiple tumor tissue array covers 53 types of benign, malignant, regional lymph node and distant metastasis tumors with normal tissues as controls, including pathology grade, TNM/Stage (AJCC 8th edition), 102 cases/102 cores(core size 1.5mm)
BCN1021 1 Each

Multiple tumor tissue array covers 53 types of benign, malignant, regional lymph node and distant metastasis tumors with normal tissues as controls, including pathology grade, TNM/Stage (AJCC 8th edition), 102 cases/102 cores(core size 1.5mm)

Sign In for Pricing
View Details
MUC6 Rabbit Monoclonal Antibody [Clone ID: LBIR2F3]
AMR11164V 100 µL

MUC6 Rabbit Monoclonal Antibody [Clone ID: LBIR2F3]

Sign In for Pricing
View Details
Rad9 (RAD9A) pSer387 Rabbit Polyclonal Antibody
AP12691PU-N 400 µL

Rad9 (RAD9A) pSer387 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
PPAR alpha (PPARA) (NM_001001928) Human Tagged ORF Clone
RG216237 10 µg

PPAR alpha (PPARA) (NM_001001928) Human Tagged ORF Clone

Sign In for Pricing
View Details
C1orf123 (Biotin)
556868-01 50 µg

C1orf123 (Biotin)

Sign In for Pricing
View Details
C1orf123 (Biotin)
556868-02 100 µg

C1orf123 (Biotin)

Sign In for Pricing
View Details