Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human LUC7L3 protein

This Human LUC7L3 protein spans the amino acid sequence from region 1-79aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

LUC7L3

UniProt

O95232

Expression Region

1-79aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Epigenetics & Chromatin

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

13.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MISAAQLLDELMGRDRNLAPDEKRSNVRWDHESVCKYYLCGFCPAELFTNTRSDLGPCEKIHDENLRKQYEKSSRFMKV

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Thyroid Stimulating Hormone (TSH) discontinued. See T5400-13J
T5400-13K 1 mg

Thyroid Stimulating Hormone (TSH) discontinued. See T5400-13J

Sign In for Pricing
View Details
IFluor® A7 Anti-human CD4 Antibody *HIT4a*
100400S0-AAT 100 Tests

IFluor® A7 Anti-human CD4 Antibody *HIT4a*

Sign In for Pricing
View Details
Recombinant human FGFR-2 Protein, Fc & His Tag
E40KMP1379 20 µg

Recombinant human FGFR-2 Protein, Fc & His Tag

Sign In for Pricing
View Details
RGD1562310 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 3)
K6316808 1.0 µg DNA

RGD1562310 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 3)

Sign In for Pricing
View Details
DNTP Mix - 10 mM Solution
orb2646547 100 mL

DNTP Mix - 10 mM Solution

Sign In for Pricing
View Details
YARS Conjugated Antibody
C39183 100 µL

YARS Conjugated Antibody

Sign In for Pricing
View Details