E.coli prn protein
This E.coli prn protein spans the amino acid sequence from region 632-910aa. Purity: Greater than 90% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
Prn
UniProt
P14283
Expression Region
632-910aa
Tag
N-terminal 6xHis-SUMO-tagged
Source
E.coli
Origin
Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251)
Field of Research
Infectious Disease & Virology
Purity
Greater than 90% as determined by SDS-PAGE.
Form
Liquid or Lyophilized powder
Molecular Weight
45.8 kDa
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
For research use only.
Applications Notes
Pertactin translocator chain of His-SUMO-tag and expression region is 632-910aa
Preservative
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
AA Sequence
ALSKRLGELRLNPDAGGAWGRGFAQRQQLDNRAGRRFDQKVAGFELGADHAVAVAGGRWHLGGLAGYTRGDRGFTGDGGGHTDSVHVGGYATYIADSGFYLDATLRASRLENDFKVAGSDGYAVKGKYRTHGVGASLEAGRRFTHADGWFLEPQAELAVFRAGGGAYRAANGLRVRDEGGSSVLGRLGLEVGKRIELAGGRQVQPYIKASVLQEFDGAGTVHTNGIAHRTELRGTRAELGLGMAAALGRGHSLYASYEYSKGPKLAMPWTFHAGYRYSW
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
A3598-05Q 50 µg
PYCARD, CT (ASC, Apoptosis-associated Speck-like Protein Containing a CARD, hASC, Caspase Recruitment Domain-containing Protein 5, PYD and CARD Domain-containing Protein, Target of Methylation-induced Silencing 1, CARD5, TMS1) discontinued. see A3598-05B
Sign In for Pricing
View Details GTR15331600 1 Vial
Lentiviral human TSPAN9 shRNA (UAS) - Lentiviral human TSPAN9 shRNA (UAS, RFP) plasmid
Sign In for Pricing
View Details 
MBS288349-01 48 Well
Chicken LIM/homeobox protein LMX-1.2 ELISA Kit
Sign In for Pricing
View Details MBS288349-02 96 Well
Chicken LIM/homeobox protein LMX-1.2 ELISA Kit
Sign In for Pricing
View Details MBS288349-03 5x 96 Well
Chicken LIM/homeobox protein LMX-1.2 ELISA Kit
Sign In for Pricing
View Details