Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

E.coli gltX1 protein

This E.coli gltX1 protein spans the amino acid sequence from region 1-463aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

GltX1

UniProt

P96551

Expression Region

1-463aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Helicobacter pylori (strain ATCC 700392 / 26695) (Campylobacter pylori)

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

69.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full length of His-SUMO-tag and expression region is 1-463aa

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MSLIVTRFAPSPTGYLHIGGLRTAIFNYLFARANQGKFFLRIEDTDLSRNSIEAANAIIEAFKWVGLEYDGEILYQSKRFEIYKEYIQKLLDEDKAYYCYMSKEELDALREEQKARKETPRYDNRYRDFKGTPPKGIEPVVRIKVPQNEVIGFNDGVKGEVKVNTNELDDFIIARSDGTPTYNFVVTIDDALMGITDVIRGDDHLSNTPKQIVLYKALNFKIPNFFHVPMILNEEGQKLSKRHGATNVMDYQEMGYLKEALVNFLARLGWSYQDKEVFSMQELLELFDPKDLNSSPSCFSWHKLNWLNAHYLKNQSVQELLKLLKPFSFSDLSHLNPTQLDRLLDALKERSQTLKELALKIDEVLIAPVEYEEKVFKKLNQALVMPLLEKFKLELNKANFNDESALENAMRQIIEEEKIKAGSFMQPLRLALLGKGGGIGLKEALFILGKTESVKRIEDFLKN

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

FNDC1 siRNA (h)
sc-95058 10 µM

FNDC1 siRNA (h)

Sign In for Pricing
View Details
ESR2 discontinued
315225 100 µL

ESR2 discontinued

Sign In for Pricing
View Details
Slc38a1 sgRNA CRISPR Lentivector set (Rat)
K6940101 3x 1.0 µg

Slc38a1 sgRNA CRISPR Lentivector set (Rat)

Sign In for Pricing
View Details
FITC-Linked Anti-Gastrokine 2 (GKN2)
FY-AB43935-01 1 mL

FITC-Linked Anti-Gastrokine 2 (GKN2)

Sign In for Pricing
View Details
FITC-Linked Anti-Gastrokine 2 (GKN2)
FY-AB43935-02 100 µL

FITC-Linked Anti-Gastrokine 2 (GKN2)

Sign In for Pricing
View Details
FITC-Linked Anti-Gastrokine 2 (GKN2)
FY-AB43935-03 200 µL

FITC-Linked Anti-Gastrokine 2 (GKN2)

Sign In for Pricing
View Details