Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

E.coli gltX1 protein

This E.coli gltX1 protein spans the amino acid sequence from region 1-463aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

GltX1

UniProt

P96551

Expression Region

1-463aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Helicobacter pylori (strain ATCC 700392 / 26695) (Campylobacter pylori)

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

69.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full length of His-SUMO-tag and expression region is 1-463aa

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MSLIVTRFAPSPTGYLHIGGLRTAIFNYLFARANQGKFFLRIEDTDLSRNSIEAANAIIEAFKWVGLEYDGEILYQSKRFEIYKEYIQKLLDEDKAYYCYMSKEELDALREEQKARKETPRYDNRYRDFKGTPPKGIEPVVRIKVPQNEVIGFNDGVKGEVKVNTNELDDFIIARSDGTPTYNFVVTIDDALMGITDVIRGDDHLSNTPKQIVLYKALNFKIPNFFHVPMILNEEGQKLSKRHGATNVMDYQEMGYLKEALVNFLARLGWSYQDKEVFSMQELLELFDPKDLNSSPSCFSWHKLNWLNAHYLKNQSVQELLKLLKPFSFSDLSHLNPTQLDRLLDALKERSQTLKELALKIDEVLIAPVEYEEKVFKKLNQALVMPLLEKFKLELNKANFNDESALENAMRQIIEEEKIKAGSFMQPLRLALLGKGGGIGLKEALFILGKTESVKRIEDFLKN

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Trdn Pre-designed siRNA Set A
SI115188A 1 Each

Mouse Trdn Pre-designed siRNA Set A

Sign In for Pricing
View Details
ADAP/FYB Recombinant Antibody, PE-Cy5 Conjugated
bsm-61997R-PE-Cy5-TR 20 µL

ADAP/FYB Recombinant Antibody, PE-Cy5 Conjugated

Sign In for Pricing
View Details
Multiplex Assay Kit for Heparan Sulfate-2-O-Sulfotransferase 1 (HS2ST1), etc. by FLIA (Flow Luminescence Immunoassay)
TRV-0031349 96 Tests

Multiplex Assay Kit for Heparan Sulfate-2-O-Sulfotransferase 1 (HS2ST1), etc. by FLIA (Flow Luminescence Immunoassay)

Sign In for Pricing
View Details
SALF (STON1-GTF2A1L) (NM_172311) Human Over-expression Lysate
E45H15100-2 20 µg

SALF (STON1-GTF2A1L) (NM_172311) Human Over-expression Lysate

Sign In for Pricing
View Details
MELA29 Cell Line
T8115 1x106 cells / 1.0 mL

MELA29 Cell Line

Sign In for Pricing
View Details
PTPN22 (Tyrosine-protein Phosphatase Non-receptor Type 22, LYP, LYP1, LYP2, PEP, PTPN8, PTPN22) (APC)
MBS6434197-01 0.1 mL

PTPN22 (Tyrosine-protein Phosphatase Non-receptor Type 22, LYP, LYP1, LYP2, PEP, PTPN8, PTPN22) (APC)

Sign In for Pricing
View Details