Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human COA1 protein

This Human COA1 protein spans the amino acid sequence from region 38-146aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

COA1

UniProt

Q9GZY4

Expression Region

38-146aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Cancer Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

39.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial of the full length of 1-146aa of GST-tag and expression region is 38-146aa

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

QKFHSRALYYKLAVEQLQSHPEAQEALGPPLNIHYLKLIDRENFVDIVDAKLKIPVSGSKSEGLLYVHSSRGGPFQRWHLDEVFLELKDGQQIPVFKLSGENGDEVKKE

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Labrings, C-form, for 125
1211722 1 Unit

Labrings, C-form, for 125

Sign In for Pricing
View Details
ANXA5 Polyclonal Antibody
E11-202326 100 µg -100 µL

ANXA5 Polyclonal Antibody

Sign In for Pricing
View Details
Human TDRKH Recombinant Protein
PPT-15608 100 µg

Human TDRKH Recombinant Protein

Sign In for Pricing
View Details
Rabbit Monoclonal ACAA2 Antibody (12F4)
NBP3-26536-50ul 50 µL

Rabbit Monoclonal ACAA2 Antibody (12F4)

Sign In for Pricing
View Details
Amphiregulin, CT (AREG, Colorectum Cell-derived Growth Factor, AREGB, AR, SDGF, CRDGF, MGC13647) (MaxLight 490) discontinued
A1585-02A-ML490 100 µL

Amphiregulin, CT (AREG, Colorectum Cell-derived Growth Factor, AREGB, AR, SDGF, CRDGF, MGC13647) (MaxLight 490) discontinued

Sign In for Pricing
View Details
KCNH6 Rabbit Polyclonal Antibody (BF647)
orb2495569 100 µL

KCNH6 Rabbit Polyclonal Antibody (BF647)

Sign In for Pricing
View Details