Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human COA1 protein

This Human COA1 protein spans the amino acid sequence from region 38-146aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

COA1

UniProt

Q9GZY4

Expression Region

38-146aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Cancer Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

39.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial of the full length of 1-146aa of GST-tag and expression region is 38-146aa

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

QKFHSRALYYKLAVEQLQSHPEAQEALGPPLNIHYLKLIDRENFVDIVDAKLKIPVSGSKSEGLLYVHSSRGGPFQRWHLDEVFLELKDGQQIPVFKLSGENGDEVKKE

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

FineTest®Violet 450 Anti-Mouse CD146 Antibody (ME-9F1)
FV450-30197-01 50 Tests

FineTest®Violet 450 Anti-Mouse CD146 Antibody (ME-9F1)

Sign In for Pricing
View Details
FineTest®Violet 450 Anti-Mouse CD146 Antibody (ME-9F1)
FV450-30197-02 100 Tests

FineTest®Violet 450 Anti-Mouse CD146 Antibody (ME-9F1)

Sign In for Pricing
View Details
M-Cresol, 6-heptyl-
T33235-01 100 mg

M-Cresol, 6-heptyl-

Sign In for Pricing
View Details
M-Cresol, 6-heptyl-
T33235-02 25 mg

M-Cresol, 6-heptyl-

Sign In for Pricing
View Details
M-Cresol, 6-heptyl-
T33235-03 50 mg

M-Cresol, 6-heptyl-

Sign In for Pricing
View Details
ASB2 Rabbit pAb, AP conjugated
orb2823913 100 µL

ASB2 Rabbit pAb, AP conjugated

Sign In for Pricing
View Details