Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human BMP3 protein

This Human BMP3 protein spans the amino acid sequence from region 363-472aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

BMP3 BMP3A

UniProt

P12645

Expression Region

363-472aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Stem Cell & Developmental Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

16.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full length of His-tag and expression region is 363-472aa

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

QWIEPRNCARRYLKVDFADIGWSEWIISPKSFDAYYCSGACQFPMPKSLKPSNHATIQSIVRAVGVVPGIPEPCCVPEKMSSLSILFFDENKNVVLKVYPNMTVESCACR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Chicken IgA ELISA Kit-Sandwich
EK11F286-01 48 Test

Chicken IgA ELISA Kit-Sandwich

Sign In for Pricing
View Details
Chicken IgA ELISA Kit-Sandwich
EK11F286-02 96 Tests

Chicken IgA ELISA Kit-Sandwich

Sign In for Pricing
View Details
E2F4/E2F5 Antibody
CSB-PA002237-01 50 µg

E2F4/E2F5 Antibody

Sign In for Pricing
View Details
E2F4/E2F5 Antibody
CSB-PA002237-02 100 µg

E2F4/E2F5 Antibody

Sign In for Pricing
View Details
FXYD2, Recombinant, Human, aa1-64, GST-Tag (Sodium/Potassium-transporting ATPase Subunit gamma)
373377-01 20 µg

FXYD2, Recombinant, Human, aa1-64, GST-Tag (Sodium/Potassium-transporting ATPase Subunit gamma)

Sign In for Pricing
View Details
FXYD2, Recombinant, Human, aa1-64, GST-Tag (Sodium/Potassium-transporting ATPase Subunit gamma)
373377-02 100 µg

FXYD2, Recombinant, Human, aa1-64, GST-Tag (Sodium/Potassium-transporting ATPase Subunit gamma)

Sign In for Pricing
View Details