Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human ARF6 protein

This Human ARF6 protein spans the amino acid sequence from region 1-175aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

ARF6

UniProt

P62330

Expression Region

1-175aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Neuroscience

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

36.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full length of His-SUMO-tag and expression region is 1-175aa

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MGKVLSKIFGNKEMRILMLGLDAAGKTTILYKLKLGQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLIFVVDCADRDRIDEARQELHRIINDREMRDAIILIFANKQDLPDAMKPHEIQEKLGLTRIRDRNWYVQPSCATSGDGLYEGLTWLTSNYKS

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

CTNNBIP1 3'UTR Lenti-reporter-Luc Vector
17075081 1.0 µg

CTNNBIP1 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details
Scutellarin 100mg
A12117-100 100 mg

Scutellarin 100mg

Sign In for Pricing
View Details
ELISA Kit For GTP-binding protein Rheb
E15524r 96 Tests

ELISA Kit For GTP-binding protein Rheb

Sign In for Pricing
View Details
ALB Rabbit Polyclonal Antibody
TA368754 100 µL

ALB Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Sex Determining Region Y Box Protein 2
549913 200 µL

Sex Determining Region Y Box Protein 2

Sign In for Pricing
View Details
LRRC47 Rabbit Polyclonal Antibody
orb628507-01 50 µg

LRRC47 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details