Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Aif1 protein

This Mouse Aif1 protein spans the amino acid sequence from region 2-147aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Aif1

UniProt

O70200

Expression Region

2-147aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Musculoskeletal & Connective Tissue Research

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

20.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full length of His-tag and expression region is 2-147aa

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

SQSRDLQGGKAFGLLKAQQEERLEGINKQFLDDPKYSNDEDLPSKLEAFKVKYMEFDLNGNGDIDIMSLKRMLEKLGVPKTHLELKRLIREVSSGSEETFSYSDFLRMMLGKRSAILRMILMYEEKNKEHKRPTGPPAKKAISELP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

EXO5 Rabbit Polyclonal Antibody
E10G02621 100 µL

EXO5 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Anti-Sialyl-di-Lewis A Antibody (FG129)
HP481023-01 50 µg

Anti-Sialyl-di-Lewis A Antibody (FG129)

Sign In for Pricing
View Details
Anti-Sialyl-di-Lewis A Antibody (FG129)
HP481023-02 100 µg

Anti-Sialyl-di-Lewis A Antibody (FG129)

Sign In for Pricing
View Details
Anti-Sialyl-di-Lewis A Antibody (FG129)
HP481023-03 1 mg

Anti-Sialyl-di-Lewis A Antibody (FG129)

Sign In for Pricing
View Details
APOBR siRNA (Mouse)
MBS828340-01 15 nmol

APOBR siRNA (Mouse)

Sign In for Pricing
View Details
APOBR siRNA (Mouse)
MBS828340-02 30 nmol

APOBR siRNA (Mouse)

Sign In for Pricing
View Details