Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Aif1 protein

This Mouse Aif1 protein spans the amino acid sequence from region 2-147aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Aif1

UniProt

O70200

Expression Region

2-147aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Musculoskeletal & Connective Tissue Research

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

20.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full length of His-tag and expression region is 2-147aa

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

SQSRDLQGGKAFGLLKAQQEERLEGINKQFLDDPKYSNDEDLPSKLEAFKVKYMEFDLNGNGDIDIMSLKRMLEKLGVPKTHLELKRLIREVSSGSEETFSYSDFLRMMLGKRSAILRMILMYEEKNKEHKRPTGPPAKKAISELP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal ACADVL Antibody
NBP1-89287 0.1 mL

Rabbit Polyclonal ACADVL Antibody

Sign In for Pricing
View Details
HECTD3 sgRNA CRISPR Lentivector (Human) (Target 3)
K0943804 1.0 µg DNA

HECTD3 sgRNA CRISPR Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
HID1 Antibody
orb1324607 100 µL

HID1 Antibody

Sign In for Pricing
View Details
(3R) -3-[[ (1,1-Dimethylethyl) dimethylsilyl]oxy]hexadecanoic Acid Ethyl Ester
428013-01 5 mg

(3R) -3-[[ (1,1-Dimethylethyl) dimethylsilyl]oxy]hexadecanoic Acid Ethyl Ester

Sign In for Pricing
View Details
(3R) -3-[[ (1,1-Dimethylethyl) dimethylsilyl]oxy]hexadecanoic Acid Ethyl Ester
428013-02 25 mg

(3R) -3-[[ (1,1-Dimethylethyl) dimethylsilyl]oxy]hexadecanoic Acid Ethyl Ester

Sign In for Pricing
View Details
Pan PDE11A Antibody FITC-Conjugated
MBS543417-01 0.1 mg

Pan PDE11A Antibody FITC-Conjugated

Sign In for Pricing
View Details