Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse IL-6

Interleukin-6 (IL-6) is an interleukin that acts as both a pro-inflammatory and anti-inflammatory cytokine. Mouse IL-6 Recombinant Protein is purified interleukin-6 produced in yeast.

Product Specifications

Source

Yeast

Field of Research

Immunology & Inflammation

Form

Lyophilized

Molecular Weight

21.7 kDa

Storage Conditions

-20°C

Notes

For research use only.

Applications Notes

The Mouse IL-10 protein can be used in cell culture, as an IL-10 ELISA Standard, and as a Western Blot Control.

AA Sequence

FPTSQVRRGDFTEDTTPNRPVYTTSQVGGLITHVLWEIVEMRKELCNGNSDCMNNDDALA ENNLKLPEIQRNDGCYQTGYNQEICLLKISSGLLEYHSYLEYMKNNLKDNKKDKARVLQR DTETLIHIFNQEVKDLHKIVLPTPISNALLTDKLESQKEWLRTKTIQFILKSLEEFLKVT LRSTRQT (187)

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal IL-31 Antibody [DyLight 594]
NBP1-77256DL594 0.1 mL

Rabbit Polyclonal IL-31 Antibody [DyLight 594]

Sign In for Pricing
View Details
Mouse Monoclonal antibody to YES1
MAB-606020185 0.1ml

Mouse Monoclonal antibody to YES1

Sign In for Pricing
View Details
Human EP300/Histone Acetyltransferase p300 ELISA Kit
MBS2890667-01 48 Well

Human EP300/Histone Acetyltransferase p300 ELISA Kit

Sign In for Pricing
View Details
Human EP300/Histone Acetyltransferase p300 ELISA Kit
MBS2890667-02 96 Well

Human EP300/Histone Acetyltransferase p300 ELISA Kit

Sign In for Pricing
View Details
Human EP300/Histone Acetyltransferase p300 ELISA Kit
MBS2890667-03 5x 96 Well

Human EP300/Histone Acetyltransferase p300 ELISA Kit

Sign In for Pricing
View Details
Human EP300/Histone Acetyltransferase p300 ELISA Kit
MBS2890667-04 10x 96 Well

Human EP300/Histone Acetyltransferase p300 ELISA Kit

Sign In for Pricing
View Details