Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse IL-6

Interleukin-6 (IL-6) is an interleukin that acts as both a pro-inflammatory and anti-inflammatory cytokine. Mouse IL-6 Recombinant Protein is purified interleukin-6 produced in yeast.

Product Specifications

Source

Yeast

Field of Research

Immunology & Inflammation

Form

Lyophilized

Molecular Weight

21.7 kDa

Storage Conditions

-20°C

Notes

For research use only.

Applications Notes

The Mouse IL-10 protein can be used in cell culture, as an IL-10 ELISA Standard, and as a Western Blot Control.

AA Sequence

FPTSQVRRGDFTEDTTPNRPVYTTSQVGGLITHVLWEIVEMRKELCNGNSDCMNNDDALA ENNLKLPEIQRNDGCYQTGYNQEICLLKISSGLLEYHSYLEYMKNNLKDNKKDKARVLQR DTETLIHIFNQEVKDLHKIVLPTPISNALLTDKLESQKEWLRTKTIQFILKSLEEFLKVT LRSTRQT (187)

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Zearalenone 10mg
A13740-10 10 mg

Zearalenone 10mg

Sign In for Pricing
View Details
Connexin 43 antibody
70R-51549 100 µL

Connexin 43 antibody

Sign In for Pricing
View Details
Anti-ErbB2 Rabbit pAb
GB11547-100 100 μL

Anti-ErbB2 Rabbit pAb

Sign In for Pricing
View Details
Lentiviral mouse Tgfb2 shRNA (UAS) - Lentiviral mouse Tgfb2 shRNA (UAS, RFP) plasmid
GTR15213361 1 Vial

Lentiviral mouse Tgfb2 shRNA (UAS) - Lentiviral mouse Tgfb2 shRNA (UAS, RFP) plasmid

Sign In for Pricing
View Details
ATHL1 siRNA (Human)
CRJ2779-01 15 nmol

ATHL1 siRNA (Human)

Sign In for Pricing
View Details
ATHL1 siRNA (Human)
CRJ2779-02 30 nmol

ATHL1 siRNA (Human)

Sign In for Pricing
View Details