FGF basic/bFGF, Bovine (His)
FGF2 protein is a multifunctional ligand that can bind to FGFR1, FGFR2, FGFR3 and FGFR4. It is also a key integrin ligand for FGF2 signal transduction and has an important interaction with the integrin ITGAV:ITGB3. FGF2 plays a critical role in cell survival, division, differentiation, and migration, serves as a potent mitogen, and induces angiogenesis. FFGF basic/bFGF protein, Bovine (His) ) is the recombinant bovine-derived FGF2 protein, expressed by E. coli , with N-6*His labeled tag.
Product Specifications
Product Name Alternative
FGF basic/bFGF protein, Bovine (His), Bovine, E. coli
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/fgf2-protein-bovine-his.html
Purity
90.00
Smiles
PALPEDGGSGAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHIKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTDECFFFERLESNNYNTYRSRKYSSWYVALKRTGQYKLGPKTGPGQKAILFLPMSAKS
Molecular Formula
281161 (Gene_ID) P03969 (P10-S155) (Accession)
Molecular Weight
20.5 kDa
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Frequently Asked Questions
Explore Other Products
Browse additional items from our catalog
![BBS1 Rabbit Monoclonal Antibody [Clone ID: R02-5J-4]](https://cdn.genprice.uk/genprice/uk/genprice5.webp)
BBS1 Rabbit Monoclonal Antibody [Clone ID: R02-5J-4]
Plekhg6 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 3)