Bacterial clpP protein
This Bacterial clpP protein spans the amino acid sequence from region 1-194aa. Purity: Greater than 90% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
Endopeptidase Clp
UniProt
A5I6W1
Expression Region
1-194aa
Tag
N-terminal 6xHis-SUMO-tagged
Source
E.coli
Origin
Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A)
Field of Research
Infectious Disease & Virology
Purity
Greater than 90% as determined by SDS-PAGE.
Form
Liquid or Lyophilized powder
Molecular Weight
37.5 kDa
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
For research use only.
Applications Notes
This is His-SUMO-tag protein
Preservative
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
AA Sequence
MSLVPVVVEQTNRGERSYDIYSRLLKDRIIMLSEEVNDTTASLIVAQLLFLEAEDPDKDIHLYINSPGGSITSGMAIYDTMQYIKPDVSTICVGMAASMGAFLLAAGAKGKRYALPNSEVMIHQPLGGFRGQATDIGIHAERILKMKKKLNTILSDRTGKPLEQVELDTERDHFLSAEEAKEYGLIDEVIDKKK
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
orb347577 1 mg
Mouse IgG3 (Gamma 3 chain) Antibody Alkaline Phosphatase Conjugated
Sign In for Pricing
View Details 
MBS9360102-01 48 Well
Porcine Regulator of G Protein Signaling 11 (RGS11) ELISA Kit
Sign In for Pricing
View Details MBS9360102-02 96 Well
Porcine Regulator of G Protein Signaling 11 (RGS11) ELISA Kit
Sign In for Pricing
View Details MBS9360102-03 5x 96 Well
Porcine Regulator of G Protein Signaling 11 (RGS11) ELISA Kit
Sign In for Pricing
View Details MBS9360102-04 10x 96 Well
Porcine Regulator of G Protein Signaling 11 (RGS11) ELISA Kit
Sign In for Pricing
View Details