Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Drosophila Trx-2 protein

This Drosophila Trx-2 protein spans the amino acid sequence from region 1-114aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Short name, DmTrx-2

UniProt

Q9V429

Expression Region

1-114aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Drosophila melanogaster (Fruit fly)

Field of Research

Metabolism Research

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

28.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-SUMO-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MMILLRDSTNLHFHLQADLDGQLTKASGKLVVLDFFATWCGPCKMISPKLVELSTQFADNVVVLKVDVDECEDIAMEYNISSMPTFVFLKNGVKVEEFAGANAKRLEDVIKANI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HPD Antibody
OC-1817-01 50 μL

HPD Antibody

Sign In for Pricing
View Details
HPD Antibody
OC-1817-02 100 µL

HPD Antibody

Sign In for Pricing
View Details
HPD Antibody
OC-1817-03 1 mL

HPD Antibody

Sign In for Pricing
View Details
MRTFA Mouse Monoclonal Antibody [Clone ID: OTI1B5]
CF805289 100 µg

MRTFA Mouse Monoclonal Antibody [Clone ID: OTI1B5]

Sign In for Pricing
View Details
Frozen Tissue Blocks, Breast
CB502831 1 Block

Frozen Tissue Blocks, Breast

Sign In for Pricing
View Details
Recombinant DENV (type 4, strain Philippines/H241/1956) NS1 Protein (His Tag)
PKSV030131 100 µg

Recombinant DENV (type 4, strain Philippines/H241/1956) NS1 Protein (His Tag)

Sign In for Pricing
View Details