Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Drosophila Trx-2 protein

This Drosophila Trx-2 protein spans the amino acid sequence from region 1-114aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Short name, DmTrx-2

UniProt

Q9V429

Expression Region

1-114aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Drosophila melanogaster (Fruit fly)

Field of Research

Metabolism Research

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

28.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-SUMO-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MMILLRDSTNLHFHLQADLDGQLTKASGKLVVLDFFATWCGPCKMISPKLVELSTQFADNVVVLKVDVDECEDIAMEYNISSMPTFVFLKNGVKVEEFAGANAKRLEDVIKANI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MCM2 Polyclonal Antibody
E-AB-14211-01 20 µL

MCM2 Polyclonal Antibody

Sign In for Pricing
View Details
MCM2 Polyclonal Antibody
E-AB-14211-02 60 µL

MCM2 Polyclonal Antibody

Sign In for Pricing
View Details
MCM2 Polyclonal Antibody
E-AB-14211-03 120 µL

MCM2 Polyclonal Antibody

Sign In for Pricing
View Details
MCM2 Polyclonal Antibody
E-AB-14211-04 200 µL

MCM2 Polyclonal Antibody

Sign In for Pricing
View Details
CORO2B Polyclonal Antibody
E-AB-19746-01 20 µL

CORO2B Polyclonal Antibody

Sign In for Pricing
View Details
CORO2B Polyclonal Antibody
E-AB-19746-02 60 µL

CORO2B Polyclonal Antibody

Sign In for Pricing
View Details