Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Drosophila Trx-2 protein

This Drosophila Trx-2 protein spans the amino acid sequence from region 1-114aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Short name, DmTrx-2

UniProt

Q9V429

Expression Region

1-114aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Drosophila melanogaster (Fruit fly)

Field of Research

Metabolism Research

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

28.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-SUMO-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MMILLRDSTNLHFHLQADLDGQLTKASGKLVVLDFFATWCGPCKMISPKLVELSTQFADNVVVLKVDVDECEDIAMEYNISSMPTFVFLKNGVKVEEFAGANAKRLEDVIKANI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ADAM8 (NM_001164489) Human Over-expression Lysate
LC431596 20 µg

ADAM8 (NM_001164489) Human Over-expression Lysate

Sign In for Pricing
View Details
Ki67 Recombinant Rabbit Monoclonal Antibody [PSH0-02]
HA721254 100 µL

Ki67 Recombinant Rabbit Monoclonal Antibody [PSH0-02]

Sign In for Pricing
View Details
Tislelizumab Biosimilar - Research Grade
ICH5004-50mg 50 mg

Tislelizumab Biosimilar - Research Grade

Sign In for Pricing
View Details
Frozen Tissue Blocks, Prostate
CB616399 1 Block

Frozen Tissue Blocks, Prostate

Sign In for Pricing
View Details
GNG4 (NM_001098721) Human Over-expression Lysate
LC420667 20 µg

GNG4 (NM_001098721) Human Over-expression Lysate

Sign In for Pricing
View Details
MUC1 / CA15-3 / EMA / CD227 (Epithelial Marker) (MUC1/2278R), Biotin conjugate, 0.1mg/mL
BNCB2278-500 1x 500 µL

MUC1 / CA15-3 / EMA / CD227 (Epithelial Marker) (MUC1/2278R), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details