Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Drosophila Trx-2 protein

This Drosophila Trx-2 protein spans the amino acid sequence from region 1-114aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Short name, DmTrx-2

UniProt

Q9V429

Expression Region

1-114aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Drosophila melanogaster (Fruit fly)

Field of Research

Metabolism Research

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

28.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-SUMO-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MMILLRDSTNLHFHLQADLDGQLTKASGKLVVLDFFATWCGPCKMISPKLVELSTQFADNVVVLKVDVDECEDIAMEYNISSMPTFVFLKNGVKVEEFAGANAKRLEDVIKANI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Nicastrin (NCSTN) Human Knockdown Lysate
LY300488 100 µg

Nicastrin (NCSTN) Human Knockdown Lysate

Sign In for Pricing
View Details
Actin Nucleation and Polymerization Antibody Sampler Kit
HAK21079 1 Kit

Actin Nucleation and Polymerization Antibody Sampler Kit

Sign In for Pricing
View Details
ENC1 (NM_003633) Human Over-expression Lysate
LC401201 20 µg

ENC1 (NM_003633) Human Over-expression Lysate

Sign In for Pricing
View Details
Human NEFL (Neurofilament, Light Polypeptide) ELISA Kit
E-EL-H6203-01 24 Tests

Human NEFL (Neurofilament, Light Polypeptide) ELISA Kit

Sign In for Pricing
View Details
Human NEFL (Neurofilament, Light Polypeptide) ELISA Kit
E-EL-H6203-02 48 Tests

Human NEFL (Neurofilament, Light Polypeptide) ELISA Kit

Sign In for Pricing
View Details
Human NEFL (Neurofilament, Light Polypeptide) ELISA Kit
E-EL-H6203-03 96 Tests

Human NEFL (Neurofilament, Light Polypeptide) ELISA Kit

Sign In for Pricing
View Details