Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human CEMP1 protein

This Human CEMP1 protein spans the amino acid sequence from region 1-247aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Cementum protein 1Cementum protein 23 , CP-23

UniProt

Q6PRD7

Expression Region

1-247aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Homo sapiens (Human)

Field of Research

Stem Cell & Developmental Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

28 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MGTSSTDSQQAGHRRCSTSNTSAENLTCLSLPGSPGKTAPLPGPAQAGAGQPLPKGCAAVKAEVGIPAPHTSQEVRIHIRRLLSWAAPGACGLRSTPCALPQALPQARPCPGRWFFPGCSLPTGGAQTILSLWTWRHFLNWALQQREENSGRARRVPPVPRTAPVSKGEGSHPPQNSNGEKVKTITPDVGLHQSLTSDPTVAVLRAKRAPEAHPPRSCSGSLTARVCHMGVCQGQGDTEDGRMTLMG

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

APC4 Polyclonal Antibody
BT-AP14237-01 20 µL

APC4 Polyclonal Antibody

Sign In for Pricing
View Details
APC4 Polyclonal Antibody
BT-AP14237-02 50 µL

APC4 Polyclonal Antibody

Sign In for Pricing
View Details
APC4 Polyclonal Antibody
BT-AP14237-03 100 µL

APC4 Polyclonal Antibody

Sign In for Pricing
View Details
KDM3A sgRNA CRISPR Lentivector (Human) (Target 1)
K1129402 1.0 µg DNA

KDM3A sgRNA CRISPR Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
CTGF Human shRNA Plasmid Kit (Locus ID 1490)
TR313671 1 Kit

CTGF Human shRNA Plasmid Kit (Locus ID 1490)

Sign In for Pricing
View Details
Mouse IL-1a Matched Antibody Pair Set [ABP-S-02200]
ABP-S-02200 5 Plates

Mouse IL-1a Matched Antibody Pair Set [ABP-S-02200]

Sign In for Pricing
View Details