Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human STH protein

This Human STH protein spans the amino acid sequence from region 1-128aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

STH

UniProt

Q8IWL8

Expression Region

1-128aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Neuroscience

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

29.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full length of His-SUMO-tag and expression region is 1-128aa

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MSEGGGQVSCIFAAPTRLCRWPALIECGVNLTQPLCEWMIQVARDRTLSLAWEVASLLTLSSSEVGLEGVGTIWPSSYSSEESSRNGAEQGRQLSIEGPFQGQNCPSHPAAALPLPMRGESQATSCQV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Endophilin-B1 (SH3GLB1) Rat ELISA Kit
D1645 96 Tests

Endophilin-B1 (SH3GLB1) Rat ELISA Kit

Sign In for Pricing
View Details
SRSF4 Protein Vector (Human) (pPM-C-HA)
PV133536 500 ng

SRSF4 Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
Recombinant TGF beta 1 (Transforming growth factor beta 1), Swine, Animal-Free
orb1178894-01 5 µg

Recombinant TGF beta 1 (Transforming growth factor beta 1), Swine, Animal-Free

Sign In for Pricing
View Details
Recombinant TGF beta 1 (Transforming growth factor beta 1), Swine, Animal-Free
orb1178894-02 20 µg

Recombinant TGF beta 1 (Transforming growth factor beta 1), Swine, Animal-Free

Sign In for Pricing
View Details
Recombinant TGF beta 1 (Transforming growth factor beta 1), Swine, Animal-Free
orb1178894-03 100 µg

Recombinant TGF beta 1 (Transforming growth factor beta 1), Swine, Animal-Free

Sign In for Pricing
View Details
Recombinant TGF beta 1 (Transforming growth factor beta 1), Swine, Animal-Free
orb1178894-04 500 µg

Recombinant TGF beta 1 (Transforming growth factor beta 1), Swine, Animal-Free

Sign In for Pricing
View Details