Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human PTH2R protein

This Human PTH2R protein spans the amino acid sequence from region 27-145aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

PTH2R

UniProt

P49190

Expression Region

27-145aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Neuroscience

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

29.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Extracellular domain of His-SUMO-tag and expression region is 27-145aa

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

DSDGTITIEEQIVLVLKAKVQCELNITAQLQEGEGNCFPEWDGLICWPRGTVGKISAVPCPPYIYDFNHKGVAFRHCNPNGTWDFMHSLNKTWANYSDCLRFLQPDISIGKQEFFERLY

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal Arrestin 3 Antibody
NBP2-41249 0.1 mg

Rabbit Polyclonal Arrestin 3 Antibody

Sign In for Pricing
View Details
RPS12P4 3'UTR Lenti-reporter-Luc Vector
42078081 1.0 µg

RPS12P4 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details
Hafnium (IV) Trifluoromethanesulfonate
280230-01 1 g

Hafnium (IV) Trifluoromethanesulfonate

Sign In for Pricing
View Details
Hafnium (IV) Trifluoromethanesulfonate
280230-02 2 g

Hafnium (IV) Trifluoromethanesulfonate

Sign In for Pricing
View Details
Hafnium (IV) Trifluoromethanesulfonate
280230-03 5 g

Hafnium (IV) Trifluoromethanesulfonate

Sign In for Pricing
View Details
Hafnium (IV) Trifluoromethanesulfonate
280230-04 10 g

Hafnium (IV) Trifluoromethanesulfonate

Sign In for Pricing
View Details