Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Hba protein

This Mouse Hba protein spans the amino acid sequence from region 2-142aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Hba

UniProt

P01942

Expression Region

2-142aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Epigenetics

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

19 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full length of His-tag and expression region is 2-142aa

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

VLSGEDKSNIKAAWGKIGGHGAEYGAEALERMFASFPTTKTYFPHFDVSHGSAQVKGHGKKVADALASAAGHLDDLPGALSALSDLHAHKLRVDPVNFKLLSHCLLVTLASHHPADFTPAVHASLDKFLASVSTVLTSKYR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mmu-miR-7210-3p miRNA Inhibitor
CIM1675-01 10 nmol

Mmu-miR-7210-3p miRNA Inhibitor

Sign In for Pricing
View Details
Mmu-miR-7210-3p miRNA Inhibitor
CIM1675-02 20 nmol

Mmu-miR-7210-3p miRNA Inhibitor

Sign In for Pricing
View Details
Human PSMD9 Protein
orb1475493-01 50 µg

Human PSMD9 Protein

Sign In for Pricing
View Details
Human PSMD9 Protein
orb1475493-02 500 µg

Human PSMD9 Protein

Sign In for Pricing
View Details
Tirasemtiv (CK-2017357)
C07066 5 mg

Tirasemtiv (CK-2017357)

Sign In for Pricing
View Details
Protein A - 100nm Gold Conjugate
AC-100-05-05 0.5 mL

Protein A - 100nm Gold Conjugate

Sign In for Pricing
View Details