Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse TNF alpha

Tumor necrosis factor alpha (TNFSF2, TNF alpha) is a member of the TNF Superfamily. TNF alpha, being an endogenous pyrogen, is able to induce fever, to induce apoptotic cell death, to induce sepsis (through IL-1 & IL-6 production), to induce cachexia, induce inflammation, and to inhibit tumorigenesis and viral replication. Mouse TNF alpha Recombinant Protein is purified TNF alpha (TNFSF2) produced in yeast.

Product Specifications

Source

Yeast

Field of Research

Immunology & Inflammation

Form

Lyophilized

Molecular Weight

17.3 kDa

Storage Conditions

-20°C

Notes

For research use only.

Applications Notes

The Mouse IL-6 protein can be used in cell culture, as an IL-6 ELISA Standard, and as a Western Blot Control.

AA Sequence

LRSSSQNSSDKPVAHVVANHQVEEQLEWLSQRANALLANGMDLKDNQLVVPADGLYLVYS QVLFKGQGCPDYVLLTHTVSRFAISYQEKVNLLSAVKSPCPKDTPEGAELKPWYEPIYLG GVFQLEKGDQLSAEVNLPKYLDFAESGQVYFGVIAL (156)

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat tissue inhibitors of metalloproteinase 1,TIMP-1 ELISA Kit
CN-01463R1 96T

Rat tissue inhibitors of metalloproteinase 1,TIMP-1 ELISA Kit

Sign In for Pricing
View Details
Thymidine Phosphorylase (TYMP) Mouse Monoclonal Antibody [Clone ID: LBI1G10]
AMM14894V 100 µL

Thymidine Phosphorylase (TYMP) Mouse Monoclonal Antibody [Clone ID: LBI1G10]

Sign In for Pricing
View Details
BCL2L14 Protein Vector (Rat) (pPB-N-His)
PV256051 500 ng

BCL2L14 Protein Vector (Rat) (pPB-N-His)

Sign In for Pricing
View Details
Benzylpenicilloic Acid Benzathide
TRC-B209965-10MG 10 mg

Benzylpenicilloic Acid Benzathide

Sign In for Pricing
View Details
TMEM59 shRNA Plasmid (m)
sc-154483-SH 20 µg

TMEM59 shRNA Plasmid (m)

Sign In for Pricing
View Details
IKK beta (IKBKB, IKKB, Inhibitor of nuclear factor kappa-B kinase subunit beta, I-kappa-B kinase 2, Nuclear factor NF-kappa-B inhibitor kinase beta) (MaxLight 750)
MBS6231287-01 0.1 mL

IKK beta (IKBKB, IKKB, Inhibitor of nuclear factor kappa-B kinase subunit beta, I-kappa-B kinase 2, Nuclear factor NF-kappa-B inhibitor kinase beta) (MaxLight 750)

Sign In for Pricing
View Details