Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse TNF alpha

Tumor necrosis factor alpha (TNFSF2, TNF alpha) is a member of the TNF Superfamily. TNF alpha, being an endogenous pyrogen, is able to induce fever, to induce apoptotic cell death, to induce sepsis (through IL-1 & IL-6 production), to induce cachexia, induce inflammation, and to inhibit tumorigenesis and viral replication. Mouse TNF alpha Recombinant Protein is purified TNF alpha (TNFSF2) produced in yeast.

Product Specifications

Source

Yeast

Field of Research

Immunology & Inflammation

Form

Lyophilized

Molecular Weight

17.3 kDa

Storage Conditions

-20°C

Notes

For research use only.

Applications Notes

The Mouse IL-6 protein can be used in cell culture, as an IL-6 ELISA Standard, and as a Western Blot Control.

AA Sequence

LRSSSQNSSDKPVAHVVANHQVEEQLEWLSQRANALLANGMDLKDNQLVVPADGLYLVYS QVLFKGQGCPDYVLLTHTVSRFAISYQEKVNLLSAVKSPCPKDTPEGAELKPWYEPIYLG GVFQLEKGDQLSAEVNLPKYLDFAESGQVYFGVIAL (156)

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Vitamin K1 Supplement
FD114-5VL 5 VL

Vitamin K1 Supplement

Sign In for Pricing
View Details
hsa-miR-223-3p miRNA Inhibitor
MIH01592 2x 5.0 nmol

hsa-miR-223-3p miRNA Inhibitor

Sign In for Pricing
View Details
Human Sorting Nexin 3 (SNX3) ELISA Kit
MBS9300195-01 48 Well

Human Sorting Nexin 3 (SNX3) ELISA Kit

Sign In for Pricing
View Details
Human Sorting Nexin 3 (SNX3) ELISA Kit
MBS9300195-02 96 Well

Human Sorting Nexin 3 (SNX3) ELISA Kit

Sign In for Pricing
View Details
Human Sorting Nexin 3 (SNX3) ELISA Kit
MBS9300195-03 5x 96 Well

Human Sorting Nexin 3 (SNX3) ELISA Kit

Sign In for Pricing
View Details
Human Sorting Nexin 3 (SNX3) ELISA Kit
MBS9300195-04 10x 96 Well

Human Sorting Nexin 3 (SNX3) ELISA Kit

Sign In for Pricing
View Details