Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human coronavirus 229E Membrane protein (M), partial

Product Specifications

Product Name Alternative

(M protein) (E1 glycoprotein) (Matrix glycoprotein) (Membrane glycoprotein)

Abbreviation

Recombinant Human coronavirus 229E Membrane protein, partial

Gene Name

M

UniProt

P15422

Expression Region

96-225aa

Organism

Human coronavirus 229E (HCoV-229E)

Target Sequence

ANSFRLFRRARTFWAWNPEVNAITVTTVLGQTYYQPIQQAPTGITVTLLSGVLYVDGHRLASGVQVHNLPEYMTVAVPSTTIIYSRVGRSVNSQNSTGWVFYVRVKHGDFSAVSSPMSNMTENERLLHFF

Tag

N-terminal 10xHis-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Microbiology

Relevance

Component of the viral envelope that plays a central role in virus morphogenesis and assembly via its interactions with other viral proteins.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

20.7 kDa

References & Citations

"Sequence analysis of the membrane protein gene of human coronavirus 229E." Jouvenne P., Richardson C.D., Schreiber S.S., Lai M.M.C., Talbot P.J. Virology 174:608-612 (1990)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human DRICH1 sgRNA gene knockout kit - Lentiviral human DRICH1 sgRNA gene knockout kit (plasmid)
GTR15378242 1 Vial

Lentiviral human DRICH1 sgRNA gene knockout kit - Lentiviral human DRICH1 sgRNA gene knockout kit (plasmid)

Sign In for Pricing
View Details
Lentiviral human RAB8A sgRNA gene knockout kit - Lentiviral human RAB8A sgRNA gene knockout kit (25)
GTR15384615 1 Vial

Lentiviral human RAB8A sgRNA gene knockout kit - Lentiviral human RAB8A sgRNA gene knockout kit (25)

Sign In for Pricing
View Details
Rabbit Polyclonal Stxbp5l Antibody
NB100-91288 0.5 mg

Rabbit Polyclonal Stxbp5l Antibody

Sign In for Pricing
View Details
Mpp6 (NM_019939) Mouse Tagged ORF Clone
MR224476 10 µg

Mpp6 (NM_019939) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Xpress™ Human PDCD6 Over-expressing Stable Cell Line
ABC-X2262 1 Vial

Xpress™ Human PDCD6 Over-expressing Stable Cell Line

Sign In for Pricing
View Details
Cordon-bleu shRNA Plasmid (h)
sc-89500-SH 20 µg

Cordon-bleu shRNA Plasmid (h)

Sign In for Pricing
View Details