Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Ganoderma lucidum Immunomodulatory protein Ling Zhi-8

Product Specifications

Product Name Alternative

LZ-8

Abbreviation

Recombinant Ganoderma lucidum Immunomodulatory protein Ling Zhi-8 protein

UniProt

P14945

Expression Region

2-111aa

Organism

Ganoderma lucidum (Ling zhi medicinal fungus) (Bracket fungus)

Target Sequence

SDTALIFRLAWDVKKLSFDYTPNWGRGNPNNFIDTVTFPKVLTDKAYTYRVAVSGRNLGVKPSYAVESDGSQKVNFLEYNSGYGIADTNTIQVFVVDPDTNNDFIIAQWN

Tag

C-terminal 6xHis-tagged

Type

In Stock Protein

Source

Yeast

Field of Research

Others

Endotoxin

Not test

Purity

Greater than 95% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

13.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cat Dentin Sialophosphoprotein ELISA Kit
MBS072843 Inquire

Cat Dentin Sialophosphoprotein ELISA Kit

Sign In for Pricing
View Details
C4orf42 Protein Vector (Human) (pPM-C-HA)
PV006511 500 ng

C4orf42 Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
Recombinant Human PPP1CC Protein, His, E.coli-100ug
QP13122-100ug 100ug

Recombinant Human PPP1CC Protein, His, E.coli-100ug

Sign In for Pricing
View Details
USP4 sgRNA CRISPR Lentivector (Human) (Target 3)
K2596204 1.0 µg DNA

USP4 sgRNA CRISPR Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
Human SECISBP2L activation kit by CRISPRa
GA106536 1 Kit

Human SECISBP2L activation kit by CRISPRa

Sign In for Pricing
View Details
Human orotate phosphoribosyltransferase (OPRT) Elisa Kit
EK714467 96 Well

Human orotate phosphoribosyltransferase (OPRT) Elisa Kit

Sign In for Pricing
View Details