Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Exodus-2/CCL21, Human

Exodus-2/CCL21 Protein, Human is a homeostatic lymphoid chemokine that contributes to the entry of T cells and dendritic cells into the lymphoid T-zone. It acts through chemokine receptors CCR7 and CXCR3 to promote fibrogenic and inflammatory cytokine production. Exodus-2/CCL21 Protein, Human is a recombinant human Exodus-2/CCL21 (S24-P134) expressed by E. coli[1].

Product Specifications

Product Name Alternative

Exodus-2/CCL21 Protein, Human, Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/exodus-2-ccl21-protein-human.html

Purity

97.00

Smiles

SDGGAQDCCLKYSQRKIPAKVVRSYRKQEPSLGCSIPAILFLPRKRSQAELCADPKELWVQQLMQHLDKTPSPQKPAQGCRKDRGASKTGKKGKGSKGCKRTERSQTPKGP

Molecular Formula

6366 (Gene_ID) O00585 (S24-P134) (Accession)

Molecular Weight

Approximately 19 kDa, based on SDS-PAGE under reducing conditions.

References & Citations

[1]Manzo A, et al. CCL21 expression pattern of human secondary lymphoid organ stroma is conserved in inflammatory lesions with lymphoid neogenesis. Am J Pathol. 2007 Nov;171 (5) :1549-62.|[2]Balsam Rizeq, et al. The Role of CCL21/CCR7 Chemokine Axis in Breast Cancer Progression. Cancers (Basel) . 2020 Apr 23;12 (4) :1036.|[3]Knut Biber, et al. Neuronal CCL21 up-regulates microglia P2X4 expression and initiates neuropathic pain development. EMBO J. 2011 May 4;30 (9) :1864-73.|[4]Marieke Bax, et al. Interaction of polysialic acid with CCL21 regulates the migratory capacity of human dendritic cells. PLoS One. 2009 Sep 14;4 (9) :e6987.|[5]Pang MF, et al. TGF-β1-induced EMT promotes targeted migration of breast cancer cells through the lymphatic system by the activation of CCR7/CCL21-mediated chemotaxis. Oncogene. 2016 Feb 11;35 (6) :748-60.|[6]Mo M, et al. CCL21/CCR7 enhances the proliferation, migration, and invasion of human bladder cancer T24 cells. PLoS One. 2015 Mar 23;10 (3) :e0119506.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD21 Antibody
orb2322188-01 10 µg

CD21 Antibody

Sign In for Pricing
View Details
CD21 Antibody
orb2322188-02 50 µg

CD21 Antibody

Sign In for Pricing
View Details
CD21 Antibody
orb2322188-03 100 µg

CD21 Antibody

Sign In for Pricing
View Details
CD21 Antibody
orb2322188-04 500 µg

CD21 Antibody

Sign In for Pricing
View Details
IFT46 siRNA Oligos set (Human)
24292171 3x 5 nmol

IFT46 siRNA Oligos set (Human)

Sign In for Pricing
View Details
Katnb1 (NM_028805) Mouse Recombinant Protein
TP523741 20 µg

Katnb1 (NM_028805) Mouse Recombinant Protein

Sign In for Pricing
View Details