Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Oncorhynchus mykiss Interleukin-10

Product Specifications

Abbreviation

Recombinant Oncorhynchus mykiss Interleukin-10 protein

UniProt

Q6L8N7

Expression Region

24-184aa

Organism

Oncorhynchus mykiss (Rainbow trout) (Salmo gairdneri)

Target Sequence

RRVPCSDRCCSFVEGFPVRLKELRTAFSTIRDYYEANDELETSLLDEGILHHLKSPVGCHAMDSILKFYLDTVLPTAMNNRTQNNNDFKSPIDSIGNIFHELKKEIVQCRNYFSCKKPFDINEFISSYEKMQDKGLYKAMGELDLLFNYIEEYLVSKRRKH

Tag

N-terminal 6xHis-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Cancer

Relevance

Immune regulatory cytokine.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

24.9 kDa

References & Citations

"Molecular cloning and expression analysis of rainbow trout (Oncorhynchus mykiss) interleukin-10 cDNAs." Inoue Y., Kamota S., Ito K., Yoshiura Y., Ototake M., Moritomo T., Nakanishi T. Fish Shellfish Immunol. 18:335-344 (2005)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD50 / ICAM3 (CG106), CF740 conjugate, 0.1mg/mL
BNC742216-100 1x 100 µL

CD50 / ICAM3 (CG106), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD20 (B9E9), CF594 conjugate, 0.1mg/mL
BNC940160-100 1x 100 µL

CD20 (B9E9), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TYRP1 (Tyrosinase Related Protein 1) (TA99), CF488A conjugate, 0.1mg/mL
BNC880806-500 1x 500 µL

TYRP1 (Tyrosinase Related Protein 1) (TA99), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Major Vault Protein (MVP) (VP2897R), CF640R conjugate, 0.1mg/mL
BNC402897-500 1x 500 µL

Major Vault Protein (MVP) (VP2897R), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Secretory Component / ECM1 (ECM1/2889R), CF594 conjugate, 0.1mg/mL
BNC942889-100 1x 100 µL

Secretory Component / ECM1 (ECM1/2889R), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD74 (LN-2), CF405S conjugate, 0.1mg/mL
BNC040056-100 1x 100 µL

CD74 (LN-2), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details