Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TL1A/TNFSF15 Protein, Human (161a.a, HEK293, His)

TL1A/TNFSF15 Protein, the receptor for TNFRSF25 and TNFRSF6B, activates NF-kappa-B and promotes caspase activation, leading to apoptosis. It also inhibits vascular endothelial growth and angiogenesis in vitro. Operating as a homotrimer, it plays a crucial role in diverse cellular processes, including immune response and apoptosis regulation. TL1A/TNFSF15 Trimer Protein, Human (HEK293, His) is the recombinant human-derived TL1A/TNFSF15 Trimer protein, expressed by HEK293 , with N-His labeled tag.

Product Specifications

Product Name Alternative

TL1A/TNFSF15 Protein, Human (161a.a, HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/tl1a-tnfsf15-trimer-protein-human-hek293-his.html

Purity

95.00

Smiles

DGDKPRAHLTVVRQTPTQHFKNQFPALHWEHELGLAFTKNRMNYTNKFLLIPESGDYFIYSQVTFRGMTSECSEIRQAGRPNKPDSITVVITKVTDSYPEPTQLLMGTKSVCEVGSNWFQPIYLGAMFSLQEGDKLMVNVSDISLVDYTKEDKTFFGAFLL

Molecular Formula

9966 (Gene_ID) O95150-1 (D91-L251) (Accession)

Molecular Weight

Approximately 20-26 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD44 Standard (156-3C11), CF640R conjugate, 0.1mg/mL
BNC400460-100 1x 100 µL

CD44 Standard (156-3C11), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD20 (B9E9), CF740 conjugate, 0.1mg/mL
BNC740160-500 1x 500 µL

CD20 (B9E9), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD71 (66IG10), CF594 conjugate, 0.1mg/mL
BNC940871-100 1x 100 µL

CD71 (66IG10), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
ACTH (Adrenocorticotrophic Hormone) (AH26), CF568 conjugate, 0.1mg/mL
BNC680026-500 1x 500 µL

ACTH (Adrenocorticotrophic Hormone) (AH26), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD50 (ICAM-3) (101-1D2), CF594 conjugate, 0.1mg/mL
BNC940177-500 1x 500 µL

CD50 (ICAM-3) (101-1D2), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD10 (CB-CALLA), CF568 conjugate, 0.1mg/mL
BNC680146-500 1x 500 µL

CD10 (CB-CALLA), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details