Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IGF2BP2, Human (T7-His)

The IGF2BP2 protein is an RNA-binding factor that coordinates the recruitment of target transcripts into cytoplasmic mRNP, promoting mRNA transport and transient storage. It regulates the contact of target transcripts with the translation machinery and protects them from microRNA-mediated degradation. IGF2BP2 Protein, Human (T7-His) is the recombinant human-derived IGF2BP2 protein, expressed by E. coli , with N-T7, C-6*His labeled tag.

Product Specifications

Product Name Alternative

IGF2BP2 Protein, Human (T7-His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/igfbp2-protein-human-t7-his.html

Purity

98.0

Smiles

MMNKLYIGNLSPAVTADDLRQLFGDRKLPLAGQVLLKSGYAFVDYPDQNWAIRAIETLSGKVELHGKIMEVDYSVSKKLRSRKIQIRNIPPHLQWEVLDGLLAQYGTVENVEQVNTDTETAVVNVTYATREEAKIAMEKLSGHQFENYSFKISYIPDEEVSSPSPPQRAQRGDHSSREQGHAPGGTSQARQIDFPLRILVPTQFVGAIIGKEGLTIKNIT

Molecular Formula

10644 (Gene_ID) Q9Y6M1-2 (M1-T220) (Accession)

Molecular Weight

Approximately 31.0 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CapZIP Lentiviral Activation Particles (h)
sc-413933-LAC 200 µL

CapZIP Lentiviral Activation Particles (h)

Sign In for Pricing
View Details
Chicken WD Repeat-Containing Protein 88 (WDR88) ELISA Kit
MBS9394537 Inquire

Chicken WD Repeat-Containing Protein 88 (WDR88) ELISA Kit

Sign In for Pricing
View Details
GENLISA™ Cystathionine (CTH) ELISA
KLR3700 1x 96 Well

GENLISA™ Cystathionine (CTH) ELISA

Sign In for Pricing
View Details
F(ab')2 Goat anti-Mouse IgG Heavy and Light Chain Antibody DyLight 594 Conjugated
MBS3907169-01 0.5 mg

F(ab')2 Goat anti-Mouse IgG Heavy and Light Chain Antibody DyLight 594 Conjugated

Sign In for Pricing
View Details
F(ab')2 Goat anti-Mouse IgG Heavy and Light Chain Antibody DyLight 594 Conjugated
MBS3907169-02 5x 0.5 mg

F(ab')2 Goat anti-Mouse IgG Heavy and Light Chain Antibody DyLight 594 Conjugated

Sign In for Pricing
View Details
CNTN5
399335-01 50 µL

CNTN5

Sign In for Pricing
View Details