Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Interleukin-33 protein (IL33), partial (Active)

Product Specifications

Product Name Alternative

IL-33, IL-1F11, Nuclear factor from high endothelial venules, NF-HEV

Abbreviation

Recombinant Human IL33 protein, partial (Active)

Gene Name

IL33

UniProt

O95760

Expression Region

112-270aa

Organism

Homo sapiens (Human)

Target Sequence

SITGISPITEYLASLSTYNDQSITFALEDESYEIYVEDLKKDEKKDKVLLSYYESQHPSNESGDGVDGKMLMVTLSPTKDFWLHANNKEHSVELHKCEKPLPDQAFFVLHNMHSNCVSFECKTDPGVFIGVKDNHLALIKVDSSENLCTENILFKLSET

Tag

Tag-Free

Type

Active Protein & In Stock Protein

Source

E.Coli

Field of Research

Immunology

Relevance

Cytokine that binds to and signals through the IL1RL1/ST2 receptor which in turn activates NF-kappa-B and MAPK signaling pathways in target cells (PubMed:16286016) . Involved in the maturation of Th2 cells inducing the secretion of T-helper type 2-associated cytokines. Also involved in activation of mast cells, basophils, eosinophils and natural killer cells. Acts as a chemoattractant for Th2 cells, and may function as an "alarmin", that amplifies immune responses during tissue injury (PubMed:17853410, PubMed:18836528) . {ECO:0000269|PubMed:16286016, ECO:0000269|PubMed:17853410, ECO:0000269|PubMed:18836528}.; In quiescent endothelia the uncleaved form is constitutively and abundantly expressed, and acts as a chromatin-associated nuclear factor with transcriptional repressor properties, it may sequester nuclear NF-kappaB/RELA, lowering expression of its targets (PubMed:21734074) . This form is rapidely lost upon angiogenic or proinflammatory activation (PubMed:18787100) . {ECO:0000269|PubMed:18787100, ECO:0000269|PubMed:21734074}.

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

>97% as determined by SDS-PAGE.

Activity

Yes

Bioactivity

Fully biologically active when compared to standard. The ED50 as determined by a cell proliferation assay using murine D10S cells is less than 0.05 ng/ml, corresponding to a specific activity of > 2.0 x 107 IU/mg.

Form

Lyophilized powder

Buffer

Lyophilized from a 0.2 μm filtered 20 mM PB, 150 mM NaCl, 1mM EDTA, pH7.4

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Cytokine that binds to and signals through the IL1RL1/ST2 receptor which in turn activates NF-kappa-B and MAPK signaling pathways in target cells

Molecular Weight

17.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SOX21 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI7D5]
TA807817AM 100 µL

SOX21 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI7D5]

Sign In for Pricing
View Details
Zfp414 Mouse Gene Knockout Kit (CRISPR)
KN519827 1 Kit

Zfp414 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
SCAPER (NM_020843) Human Over-expression Lysate
LC432447 20 µg

SCAPER (NM_020843) Human Over-expression Lysate

Sign In for Pricing
View Details
Ethyl 2,2-Dichloro-2-nitroacetate
TRC-E925217-50MG 50 mg

Ethyl 2,2-Dichloro-2-nitroacetate

Sign In for Pricing
View Details
Liver Canuliculi (HSA98), Biotin conjugate, 0.1mg/mL
BNCB0098-500 1x 500 µL

Liver Canuliculi (HSA98), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytisus sscoparius Gel -CSA- Immobilized Lectin
AK-3201-2 2 mL

Cytisus sscoparius Gel -CSA- Immobilized Lectin

Sign In for Pricing
View Details