Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

UBE2M, Human

UBE2M Protein is a crucial mediator in the ubiquitin-like protein NEDD8 conjugation pathway. It accepts NEDD8 from the UBA3-NAE1 E1 complex, covalently attaching it to target proteins like CUL1, CUL2, CUL3, and CUL4, particularly interacting with the E3 ubiquitin ligase RBX1. This specificity in neddylating specific targets suggests a pivotal role in regulating cellular processes, notably contributing to cell proliferation. UBE2M Protein, Human is the recombinant human-derived UBE2M protein, expressed by E. coli , with tag free.

Product Specifications

Product Name Alternative

UBE2M Protein, Human, Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ube2m-protein-human.html

Purity

98.0

Smiles

MIKLFSLKQQKKEEESAGGTKGSSKKASAAQLRIQKDINELNLPKTCDISFSDPDDLLNFKLVICPDEGFYKSGKFVFSFKVGQGYPHDPPKVKCETMVYHPNIDLEGNVCLNILREDWKPVLTINSIIYGLQYLFLEPNPEDPLNKEAAEVLQNNRRLFEQNVQRSMRGGYIGSTYFERCLK

Molecular Formula

9040 (Gene_ID) P61081 (M1-K183) (Accession)

Molecular Weight

19-25.0 kDa

Shipping Conditions

Dry ice.

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Aryl Hydrocarbon Receptor Interacting Protein (AIP) Protein
abx261466-01 5 µg

Aryl Hydrocarbon Receptor Interacting Protein (AIP) Protein

Sign In for Pricing
View Details
Aryl Hydrocarbon Receptor Interacting Protein (AIP) Protein
abx261466-02 20 µg

Aryl Hydrocarbon Receptor Interacting Protein (AIP) Protein

Sign In for Pricing
View Details
Aryl Hydrocarbon Receptor Interacting Protein (AIP) Protein
abx261466-03 1 mg

Aryl Hydrocarbon Receptor Interacting Protein (AIP) Protein

Sign In for Pricing
View Details
ZNF193 ORF Vector (Human) (pORF)
ORF011857 1.0 µg DNA

ZNF193 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
ANKRD40 Rabbit pAb, PE-Cy5.5 conjugated
orb2853695 100 µL

ANKRD40 Rabbit pAb, PE-Cy5.5 conjugated

Sign In for Pricing
View Details
Human Aquaporin-2 ELISA Kit
EK1974 Inquire

Human Aquaporin-2 ELISA Kit

Sign In for Pricing
View Details