Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

UBE2M, Human

UBE2M Protein is a crucial mediator in the ubiquitin-like protein NEDD8 conjugation pathway. It accepts NEDD8 from the UBA3-NAE1 E1 complex, covalently attaching it to target proteins like CUL1, CUL2, CUL3, and CUL4, particularly interacting with the E3 ubiquitin ligase RBX1. This specificity in neddylating specific targets suggests a pivotal role in regulating cellular processes, notably contributing to cell proliferation. UBE2M Protein, Human is the recombinant human-derived UBE2M protein, expressed by E. coli , with tag free.

Product Specifications

Product Name Alternative

UBE2M Protein, Human, Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ube2m-protein-human.html

Purity

98.0

Smiles

MIKLFSLKQQKKEEESAGGTKGSSKKASAAQLRIQKDINELNLPKTCDISFSDPDDLLNFKLVICPDEGFYKSGKFVFSFKVGQGYPHDPPKVKCETMVYHPNIDLEGNVCLNILREDWKPVLTINSIIYGLQYLFLEPNPEDPLNKEAAEVLQNNRRLFEQNVQRSMRGGYIGSTYFERCLK

Molecular Formula

9040 (Gene_ID) P61081 (M1-K183) (Accession)

Molecular Weight

19-25.0 kDa

Shipping Conditions

Dry ice.

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

AKT1 (Phospho-Thr308) Rabbit pAb
MBS8554152-01 0.1 mL

AKT1 (Phospho-Thr308) Rabbit pAb

Sign In for Pricing
View Details
AKT1 (Phospho-Thr308) Rabbit pAb
MBS8554152-02 0.1 mL (AF405L)

AKT1 (Phospho-Thr308) Rabbit pAb

Sign In for Pricing
View Details
AKT1 (Phospho-Thr308) Rabbit pAb
MBS8554152-03 0.1 mL (AF405S)

AKT1 (Phospho-Thr308) Rabbit pAb

Sign In for Pricing
View Details
AKT1 (Phospho-Thr308) Rabbit pAb
MBS8554152-04 0.1 mL (AF610)

AKT1 (Phospho-Thr308) Rabbit pAb

Sign In for Pricing
View Details
AKT1 (Phospho-Thr308) Rabbit pAb
MBS8554152-05 0.1 mL (AF635)

AKT1 (Phospho-Thr308) Rabbit pAb

Sign In for Pricing
View Details
AKT1 (Phospho-Thr308) Rabbit pAb
MBS8554152-06 0.1 mL (APC)

AKT1 (Phospho-Thr308) Rabbit pAb

Sign In for Pricing
View Details