Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SIRP alpha/CD172a, Mouse (HEK293, His)

The SIRP α/CD172a protein is an immunoglobulin-like cell surface receptor for CD47 and is essential for the translocation of binding partners to the plasma membrane.It plays a key role in a variety of cellular processes, supporting the adhesion of cerebellar neurons, promoting neurite outgrowth, and promoting glial cell attachment.SIRP alpha/CD172a Protein, Mouse (HEK293, His) is the recombinant mouse-derived SIRP alpha/CD172a protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

SIRP alpha/CD172a Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/sirp-alpha-cd172a-protein-mouse-hek-293-his.html

Purity

98.0

Smiles

KELKVTQPEKSVSVAAGDSTVLNCTLTSLLPVGPIRWYRGVGPSRLLIYSFAGEYVPRIRNVSDTTKRNNMDFSIRISNVTPADAGIYYCVKFQKGSSEPDTEIQSGGGTEVYVLAKPSPPEVSGPADRGIPDQKVNFTCKSHGFSPRNITLKWFKDGQELHPLETTVNPSGKNVSYNISSTVRVVLNSMDVNSKVICEVAHITLDRSPLRGIANLSNFIRVSPTVKVTQQSPTSMNQVNLTCRAERFYPEDLQLIWLENGNVSRNDTPKNLTKNTDGTYNYTSLFLVNSSAHREDVVFTCQVKHDQQPAITRNHTVLGFAHSSDQGSMQTFPDNNATHNWN

Molecular Formula

19261 (Gene_ID) P97797-1/Q6P6I8/BAA13520.1 (K32-N373) (Accession)

Molecular Weight

Approximately 55-110 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse cTnT/TNNT2 (Troponin T Type 2, Cardiac) CLIA Kit
MBS2531940-01 96 Tests

Mouse cTnT/TNNT2 (Troponin T Type 2, Cardiac) CLIA Kit

Sign In for Pricing
View Details
Mouse cTnT/TNNT2 (Troponin T Type 2, Cardiac) CLIA Kit
MBS2531940-02 5x 96 Tests

Mouse cTnT/TNNT2 (Troponin T Type 2, Cardiac) CLIA Kit

Sign In for Pricing
View Details
Neural Proliferation, Differentiation And Control 1 (NPDC1) Antibody
abx327626-01 50 µg

Neural Proliferation, Differentiation And Control 1 (NPDC1) Antibody

Sign In for Pricing
View Details
Neural Proliferation, Differentiation And Control 1 (NPDC1) Antibody
abx327626-02 100 µg

Neural Proliferation, Differentiation And Control 1 (NPDC1) Antibody

Sign In for Pricing
View Details
Rabbit Anti-Human IL33 pAb
PA6247-01 50 μL

Rabbit Anti-Human IL33 pAb

Sign In for Pricing
View Details
Rabbit Anti-Human IL33 pAb
PA6247-02 100 μL

Rabbit Anti-Human IL33 pAb

Sign In for Pricing
View Details